KEGG   Candida tropicalis: CTRG_00664Help
Entry
CTRG_00664        CDS       T01115                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRPFNNRGFAEIVFCAISSTEQVRGYGA
HLMNHLKDYVRATSPIKYFLTYADNYAIGYFKKQGFTKEISLDKSVWMGYIKDYEGGTLM
QCSMLPSILRYLDSGKILLLQKAAIERKIKSRSKSNVVRPGLQVFKTNQNVTLDPKDIPG
LLEAGWNEEMDKLAQKPKRGPHYNFMVTLFSEMQNHPSAWPFAVPVNKEEVPDYYEVIKE
PMDLSTMESKLENDKYESFDQFLYDARLIYKNCRSYNGETTTYYKNANKLEKFMNNKIKD
SAEYSHYLDS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgaatatatttctcgtttggtttatgacagatcacatttgtcaatggcagtg
gttagaaaaccacttacagttgtgggaggtataacatatagaccatttaataatcgtgga
tttgcagaaattgtcttttgtgccatttcttctactgaacaagttcgtggttatggtgca
catttgatgaatcatttgaaggattatgttagagcaacatcaccaataaagtattttttg
acatatgctgataactatgctattggttactttaagaagcaagggtttacaaaagagatc
tcgttagacaaatctgtatggatgggttatataaaagattatgaaggtggtaccttgatg
cagtgttccatgttgcctagcatattgagatatctagatctggggaagattttacttttg
cagaaagctgcaattgagaggaaaataaaatcgagatcaaagtcgaatgttgtaaggcct
ggattacaagtatttaagaccaatcaaaacgtgactttggatccaaaagatatacctggc
ttgctagaggcagggtggaatgaggagatggataagttggctcaaaaacctaaacgagga
ccacattacaatttcatggttactttattcagcgaaatgcaaaaccacccttcagcttgg
ccatttgctgttcccgtgaacaaggaagaagttcctgactattatgaggtaataaaagag
ccaatggatttgtcaactatggagctgaaattggagaatgataaatatgaatcgtttgat
caattcttatatgatgccagattaatttacaagaattgtcgatcctacaacggtgagaca
acaacctattacaagaatgcaaataaattggagaagtttatgaataataagatcaaagat
agtgccgagtatagccattatttagattcgtaa

DBGET integrated database retrieval system