KEGG   Candida tropicalis: CTRG_00710Help
Entry
CTRG_00710        CDS       T01115                                 

Definition
protein kinase byr1
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 557 aa AA seqDB search
MSKLNRLDLTDDIREKELPPVPSSVSQTLDQPLMETKSLRRKNFKKLSLDASPVKSKENL
ISNDTMDIREPTSLRQKRQRPAPILNLSNSSSSVSNTPAQIPTSSTSSLAFSQQSPGSGA
IVSQTLSRPTSAGGKAGPGSSSTSPFNINRSNRNVDPDNEASTDLILNQISNLDLSNMNH
HQQRLHQNNHHHLPSRKRQTVISSISPTKSTSSSPLEPKPQLVTDAQSPIATTSSLKLNS
KDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHIDSKSVIQTQIIRELRILHECHSPY
IIEFYGACLNNNNTIVICMEYCNCGSLDKILPLCDNKQFPTFVLKKLSFAILSGLTYLYT
THKIIHRDIKPNNVLMTHRGDFKLCDFGVSRELTNSLAMADTFVGTSMYMSPERIQGMDY
GVKSDVWSTGLMLIELASGLPVWTDDDDDEEEGNGQSNGINDMNSYNGPEGILDLLQRIV
NEDAPTLTNKINNVTKQPYDKKLCEFIDACLIKDDASRKTPWQLLDDKDGFLKGVEEGIY
DKEHKHWAKKIRKLKNL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattaaatcgtttggatcttacagacgatattcgagaaaaggaattaccacct
gttccaagttctgtcagtcaaactttagatcaaccgttaatggaaaccaaaagtttgaga
agaaagaactttaagaaactttctttggacgcctccccagtcaaatccaaagagaatcta
atctccaacgatacaatggatatcagagaaccaacatcattacgacaaaagaggcaacgt
ccagctccaattctcaatttatccaattcatcttcatcagtttcaaatacccctgcacaa
atacccacatcatctacatcatcattggcattttctcaacaatcacctggatcaggtgca
attgtcagtcaaactttgagtcgacctacaagtgctggtggaaaagctggtcctggatca
tcctccacttcaccttttaatatcaatagaagtaatagaaatgttgacccggacaatgag
gcatccaccgatttaatattaaatcagatatcaaacttggatttatcaaatatgaatcat
caccaacaacgtctccatcagaacaatcatcaccatttaccgagtcgtaagagacaaact
gttatatcttccatatcaccaaccaaatccacttcatcatccccgttagagccgaaacca
caactagtaacagatgcacaatctcctatagcaacaaccagttcattgaaattgaatagt
aaagatttgttgactttaaagcaattgggatctggtaactctggttcggtgtccaagatc
ttgcatatacccactcaaaaaacaatggctaaaaaaattattcatattgacctgaaaagt
gttatccaaacccaaattattcgtgagttaagaatactacatgaatgccactcaccgtat
attattgaattttacggggcatgtttaaacaataataacactattgttatttgtatggag
tactgtaattgtggttctttggataagatcttgccgctttgcgacaataaacaatttcca
acttttgtcttaaagaaactttcttttgctatattatctggtttgacatatttgtatact
acacataagattattcatcgtgatattaagccaaataatgttttaatgacacataggggt
gatttcaagttgtgtgattttggtgtttctcgtgaattaacgaattctcttgcaatggca
gatacttttgttggtacttcaatgtatatgtccccagaaagaattcaaggtatggattat
ggtgtgaagtcagacgtttggtctactggcttgatgttaatagaattggccagtggcctt
ccagtatggacagatgatgatgatgatgaggaggagggtaatggccaatccaatggaatc
aacgatatgaattcatataatggccctgaaggtattttggatttattacaacgaattgtc
aatgaagatgcgccaacattaacaaacaagatcaataatgttaccaaacaaccttatgat
aagaaattatgtgagtttattgatgcatgcttaatcaaggatgatgctctgagaaaaact
ccatggcagttattggatgacaaagacgggttcttgaaaggagttgaagaaggtatatat
gacaaagaacataaacactgggctaagaaaattagaaaacttaaaaatttataa

DBGET integrated database retrieval system