KEGG   Candida tropicalis: CTRG_00710Help
Entry
CTRG_00710        CDS       T01115                                 

Definition
protein kinase byr1
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ctp  Candida tropicalis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CTRG_00710
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CTRG_00710
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CTRG_00710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 557 aa AA seqDB search
MSKLNRLDLTDDIREKELPPVPSSVSQTLDQPLMETKSLRRKNFKKLSLDASPVKSKENL
ISNDTMDIREPTSLRQKRQRPAPILNLSNSSSSVSNTPAQIPTSSTSSLAFSQQSPGSGA
IVSQTLSRPTSAGGKAGPGSSSTSPFNINRSNRNVDPDNEASTDLILNQISNLDLSNMNH
HQQRLHQNNHHHLPSRKRQTVISSISPTKSTSSSPLEPKPQLVTDAQSPIATTSSLKLNS
KDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHIDSKSVIQTQIIRELRILHECHSPY
IIEFYGACLNNNNTIVICMEYCNCGSLDKILPLCDNKQFPTFVLKKLSFAILSGLTYLYT
THKIIHRDIKPNNVLMTHRGDFKLCDFGVSRELTNSLAMADTFVGTSMYMSPERIQGMDY
GVKSDVWSTGLMLIELASGLPVWTDDDDDEEEGNGQSNGINDMNSYNGPEGILDLLQRIV
NEDAPTLTNKINNVTKQPYDKKLCEFIDACLIKDDASRKTPWQLLDDKDGFLKGVEEGIY
DKEHKHWAKKIRKLKNL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattaaatcgtttggatcttacagacgatattcgagaaaaggaattaccacct
gttccaagttctgtcagtcaaactttagatcaaccgttaatggaaaccaaaagtttgaga
agaaagaactttaagaaactttctttggacgcctccccagtcaaatccaaagagaatcta
atctccaacgatacaatggatatcagagaaccaacatcattacgacaaaagaggcaacgt
ccagctccaattctcaatttatccaattcatcttcatcagtttcaaatacccctgcacaa
atacccacatcatctacatcatcattggcattttctcaacaatcacctggatcaggtgca
attgtcagtcaaactttgagtcgacctacaagtgctggtggaaaagctggtcctggatca
tcctccacttcaccttttaatatcaatagaagtaatagaaatgttgacccggacaatgag
gcatccaccgatttaatattaaatcagatatcaaacttggatttatcaaatatgaatcat
caccaacaacgtctccatcagaacaatcatcaccatttaccgagtcgtaagagacaaact
gttatatcttccatatcaccaaccaaatccacttcatcatccccgttagagccgaaacca
caactagtaacagatgcacaatctcctatagcaacaaccagttcattgaaattgaatagt
aaagatttgttgactttaaagcaattgggatctggtaactctggttcggtgtccaagatc
ttgcatatacccactcaaaaaacaatggctaaaaaaattattcatattgacctgaaaagt
gttatccaaacccaaattattcgtgagttaagaatactacatgaatgccactcaccgtat
attattgaattttacggggcatgtttaaacaataataacactattgttatttgtatggag
tactgtaattgtggttctttggataagatcttgccgctttgcgacaataaacaatttcca
acttttgtcttaaagaaactttcttttgctatattatctggtttgacatatttgtatact
acacataagattattcatcgtgatattaagccaaataatgttttaatgacacataggggt
gatttcaagttgtgtgattttggtgtttctcgtgaattaacgaattctcttgcaatggca
gatacttttgttggtacttcaatgtatatgtccccagaaagaattcaaggtatggattat
ggtgtgaagtcagacgtttggtctactggcttgatgttaatagaattggccagtggcctt
ccagtatggacagatgatgatgatgatgaggaggagggtaatggccaatccaatggaatc
aacgatatgaattcatataatggccctgaaggtattttggatttattacaacgaattgtc
aatgaagatgcgccaacattaacaaacaagatcaataatgttaccaaacaaccttatgat
aagaaattatgtgagtttattgatgcatgcttaatcaaggatgatgctctgagaaaaact
ccatggcagttattggatgacaaagacgggttcttgaaaggagttgaagaaggtatatat
gacaaagaacataaacactgggctaagaaaattagaaaacttaaaaatttataa

DBGET integrated database retrieval system