KEGG   Candida tropicalis: CTRG_00823Help
Entry
CTRG_00823        CDS       T01115                                 

Definition
(RefSeq) histone deacetylase RPD3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ctp  Candida tropicalis
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CTRG_00823
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CTRG_00823
Chromosome [BR:ctp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CTRG_00823
   HDAC complexes
    Sin3A-HDAC complex
     CTRG_00823
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CTRG_00823
  Chromatin remodeling factors
   NuRD complex
    CTRG_00823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MYVELPFDEIKVNPIKKRVAYFYDQDVGNYFYGTGHCMKPHRIRMAHSLIMNYELDKKME
IYRAQPATNLEMTQFHTDEYIDFIDRVSPDNLHLFQREQVIFNVGDDCPVFDGLGEFCKI
SCGGSMEGAARLNNGSADIAINYAGGLHHAKKSEASGFCYTNDIVLAIIELLRYHPRVLY
IDIDVHHGDGVEEAFYTNDRVMTCSFHKYGEFFPGTGNLNDIGIGNGKYHSVNVPLRDGI
DDATYKSVFEPVISKIMEWYQPSAIVLQCGGDSLSGDRLGPFNLSMRGHANCVNFVRSFN
VPFMVVGGGGYTIRNVARTWAFETGICNGVILPKELPYNGYYEYYAPTYELDVRSSNMNN
ANSKEYLDKILTQLISNLDHTKHAPSVQMNEVPRDPEDWGDIEEDTPMAIDTKGGSQMAR
DKMIQGENEFYDDDEKDRGEKNIEENGKSNGNVNGNTNGILTDQEQAEISELNNES
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtggaacttccatttgatgagattaaagtaaatcccataaagaaaagagtagct
tatttctatgatcaagatgttgggaattatttctatggtacaggacattgtatgaaacca
catagaataagaatggctcattcattaattatgaattatgaattagataaaaaaatggaa
atttatcgagctcaaccagctactaatttagaaatgacacagtttcatactgatgaatat
attgattttattgatagagtttcacctgataatttacatctttttcaacgtgaacaagtt
atatttaatgttggtgatgattgtcctgtttttgatggattaggtgaattttgtaaaatt
tcatgtggtggatctatggaaggggcagcaaggttaaacaacggtctggctgatattgcc
attaattatgctggtggtttacatcatgctaagaaatcagaagcaagtggattttgttat
actaatgatattgtattggcaattattgagttattaagatatcatccaagagtattgtat
attgatattgatgttcatcatggtgatggggttgaagaagccttttatacaaatgacaga
gttatgacatgttcgtttcataaatatggtgaatttttccccggaactggtaatttgaat
gatattggtataggaaatgggaaatatcattctgtcaatgtcccattaagagatgggatt
gatgatgctacttataaatctgtatttgaacctgttattagtaaaatcatggaatggtat
caaccatctgctattgttttacaatgtggtggtgattcattaagtggtgatagattaggt
ccatttaatttatctatgagaggtcatgccaactgtgtcaattttgttagatcattcaat
gttccattcatggttgttggtggtggtggatataccattagaaatgttgctcgtacatgg
gcatttgaaactggtatttgtaatggggtgatattacctaaagaattaccatataatgga
tattatgaatattatgccccaacttatgaattagatgttcgatcgtcaaatatgaataac
gcaaattcaaaagaatatctagataaaatacttacacaattgatttccaatcttgatcat
actaaacatgccccatcggtacagatgaatgaagtcccacgtgatcccgaagattggggt
gatattgaagaagatacaccaatggcaatagatacaaaaggtggatcacaaatggctaga
gataaaatgatacaaggtgagaatgaattttatgacgatgatgagaaagaccgcggtgaa
aaaaatattgaagaaaatgggaagtccaatggaaatgtaaatgggaatactaatggaata
ttaacagatcaagaacaagccgaaatatctgaattaaataacgagtcctga

DBGET integrated database retrieval system