KEGG   Candida tropicalis: CTRG_00882Help
Entry
CTRG_00882        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00071  Fatty acid degradation
ctp00350  Tyrosine metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_00882
  Lipid metabolism
   00071 Fatty acid degradation
    CTRG_00882
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTRG_00882
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CTRG_00882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N NAD_binding_7 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 8297297
NCBI-ProteinID: XP_002546101
UniProt: C5M493
Position
Unknown
AA seq 366 aa AA seqDB search
MSLVLKRLLPIRSTSLLNSKLTQFQTQLRTMAIPATQTGFFFTKEQGLKYRTDIPVPKPQ
AGQLLMKVNAVGLCHSDLHVIDKELECGDNYVMGHEIAGTIAELGPEVVGFKVGDRVACV
GPNGCGVCKHCLTGNDNVCKTAFLDWFGLGADGGYEEYLLVRRPRNLVKVPDNVSIEAAA
AITDAVLTPYHAVKTAKIKPTSNVLVVGAGGLGGNGIQIVKAFGGKVTVLDKKQKARDQA
KKLGADEVYDELPASIEPGSFDVCLDFVSVQATYDICQKYCEPKGIIIPVGLGAPKLAID
LADLDLREITVTGTFWGAANDLREAFELVSQGKIKPVVSHAPLKELPDYIEKLKKGAYEG
RVVFHP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttgttctcaagagattacttccaatcagatctacaagtttacttaattctaaa
ttaactcaattccaaactcaattacgtacaatggctattcctgctactcagactggtttc
tttttcactaaagagcaagggttaaaatacagaacagatatccctgttccaaaaccacaa
gctggtcaattgttgatgaaggtcaatgctgtgggactttgtcattctgacttgcatgtc
attgacaaagaacttgaatgtggtgataattatgttatgggtcatgaaattgcaggcact
attgcagaacttggtcctgaagttgtaggattcaaagttggtgaccgtgttgcgtgtgtt
ggtcctaatggttgtggtgtttgtaaacattgtttaactgggaacgacaatgtttgtaag
actgcttttctcgactggttcgggttaggtgcagatggtggctatgaagaatatttgttg
gttagaagaccaagaaatttagttaaagttcctgataatgtttccattgaagctgctgct
gctattactgatgctgttttaactccttatcatgctgtcaagactgccaaaattaaacca
actagtaatgttttggttgttggtgctggtggattaggtggaaatggtattcaaattgtt
aaagcatttggtggtaaagttactgttttagataagaaacaaaaggctcgtgatcaagct
aaaaaattgggtgctgatgaggtctatgatgaattaccagcaagtattgagccaggatca
tttgatgtttgtcttgattttgtttctgttcaagccacttatgacatttgtcaaaagtac
tgtgaaccaaaaggaattattattccagttggtttaggtgccccaaaacttgcaattgat
ttggctgatttggatctccgtgaaattactgttactggtacattctggggtgctgccaac
gatttgagagaggcatttgaattggttagtcaaggaaagatcaaacctgttgtttctcat
gctccattgaaagaattaccagattacattgaaaaattgaagaaaggtgcatatgaagga
agagttgttttccatccatga

DBGET integrated database retrieval system