KEGG   Candida tropicalis: CTRG_00883Help
Entry
CTRG_00883        CDS       T01115                                 

Definition
histone deacetylase HDA1
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CTRG_00883
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTRG_00883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 849 aa AA seqDB search
MSVGPEQQEQSSQKTRLEEEKEKECENPQQTTDEKQPAKVGNSNAAHDTKQEISEQDSIE
VKQEPKEEEEKEERPVVTLKREIEETTIVNGDSLDQNEEPSTKKIKLEESNGSSIVATIP
KEQRIVVTPPKKPQLFYIPLKTGLVYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKR
LVEAGLVQDSSLSGVDEIGPFMLKIPIREATTEEILEVHSESHLNFIQNTESMSRDQLLE
ETEKGDSIYVNNDSYLSAKLSCGGTIEACKAVIEGKVKNSLAVVRPPGHHAEPDTPAGFC
LFSNVAVAAKNILKNYPESVRRIVIVDWDIHHGNGTQKAFYNDPRVLYISLHRYENGKFY
PGTKYGNSDQVGEGPGEGYNINIPWRSMGMHDGDYVYAFNKILLPAITEFDPDLIIVSSG
FDAADGDVIGGCHVSPSGYGYMTHMLKGIAKGKMAVVLEGGYNLDSIAKSALAVAKVLVG
EPPESTITLLPHLETIEVVDEVIKIQSKYFKSLRHGIPEKIFEDVYELPGVENPNYKLVN
IADPIRSHQANDMFNKRAFVNLPIINSTNENEKPSFSVDLPDQLEDLIIASPDIYDCTTI
ILTIHDPPDIWANVNPTNGVIESNSTIVLEHPLNQLIEKIQKEKDPENKEKFGYIDINVP
SFQLPIPGLSSDPSTYNPIIFAQEVLLYIWDNYITYFQQLKKLVLVGFGDSYQSIVHLYG
KRNSQEVKELVKGTVAFLNKTQLKPVVPVMDESMVEWYYKNSLIFTGCSNSCWNGTNGSG
GSSSSGGSSGSNGKSDSGEEYSNKRPRKKFGRVIKSKSDGLPDVIQDKFDEGVDFILDSI
EDFSASEDS
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtggggccagaacaacaggaacaaagcctgcaaaaaaccagactagaagaagaa
aaagaaaaggaatgtgaaaacccacaacaaacaacagatgaaaaacaaccagcgaaagtt
ggcaatagtaatgctgctcatgataccaaacaagagatcctggagcaagattcaatagaa
gtcaaacaagaaccaaaggaagaagaagagaaggaagagcgtccagttgttaccttgaag
agagaaattgaagaaacaacaattgtaaacggcgattccctcgatcaaaatgaagaaccc
tccaccaaaaaaattaaattggaagaatctaacggaagcagtattgtagccactattcca
aaagagcaaagaattgttgttacacctcctaaaaaaccacaactattttatatccctcta
aaaacaggtttggtttatgatgtaagaatgagatatcatgcaaagatctttacatcatat
tttgaatatatcgacccacatccagaagatcctcgtcgtatttacagaatctacaaaaga
ttggtcgaagcaggtttagtacaagattcatctttatcgggagttgacgaaatcggacca
ttcatgttgaagattcctattagagaagcaaccacagaagaaatattggaagtacattcc
gaaagtcatttgaatttcattcaaaataccgaatcaatgtctagagatcaactacttgag
gaaacagaaaaaggtgactccatatatgtcaacaatgactcctacttatcggccaaacta
tcatgtggtggtaccatcgaagcatgtaaagcggttattgaaggaaaagttaaaaattca
ttggctgttgttagaccaccgggtcatcatgctgagccagatacaccagctgggttctgt
ttatttagtaatgttgccgttgctgctaagaatatattgaaaaattatcctgaatctgtc
agaagaattgttattgtggattgggatattcaccatgggaatggtactcagaaagccttt
tacaacgatccaagagttttatatatatctttgcaccgttatgaaaatgggaaattctat
ccaggaacaaagtatggtaactccgatcaagttggtgaaggtccaggagaaggttacaat
ataaatattccttggagatccatgggtatgcatgatggagattatgtttatgcctttaat
aaaatattgttgccagcgataacagaatttgatccagatttaattattgtcagttcaggt
tttgatgcagctgatggtgatgtcattggtggatgtcatgtgagtccttctggttatgga
tacatgacccatatgttgaagggtatcgctaagggtaagatggctgttgtgttagaaggt
ggttacaacttggattcaattgccaaaagtgcattggctgtggctaaggtcttggttggc
gaacctccagaaagtactattactttgcttcctcatttagagacaattgaggttgtggat
gaagttattaaaattcaatcaaaatatttcaaatcattgagacatggtatcccagagaaa
atttttgaagacgtttatgagttaccaggagttgaaaatccaaactacaagcttgttaac
attgctgatccaatacgttcgcatcaagcaaatgacatgtttaacaaacgtgctttcgtt
aatcttccaattatcaattccaccaatgaaaacgaaaaaccttcatttagtgtagattta
cctgatcaattggaagatttaatcattgccagtcctgatatctacgattgcactactata
atactaacgattcatgaccctccagatatctgggctaatgttaatcctaccaatggggtg
attgagagtaactcgacaattgtgttggagcatccattgaatcaactaattgagaaaatt
caaaaagaaaaagatccagagaataaagaaaaattcggatatattgatattaatgtacct
tctttccaactcccaatacctggattatcatcggatccatctacttacaatccaatcata
tttgcacaagaagtattattatacatttgggataattatatcacatatttccaacaattg
aagaaattggttcttgttgggtttggtgatagttatcaatcaattgttcatttatatgga
aagagaaattctcaagaggttaaagaattagttaaaggtacggttgcattcttgaataaa
actcaattgaaacctgtagtacctgtaatggatgaatcaatggttgaatggtattataaa
aattctttaattttcacaggttgttcaaattcatgttggaatggtactaatggtagtgga
ggaagttcatcaagtggaggatccagtggatctaatggtaaaagtgattcaggagaagaa
tattcaaataaacgtccaagaaagaaatttggtagagttattaaatcaaaatctgatgga
ttaccagatgtgatacaagataaatttgatgaaggtgtagatttcatcttggattccatc
gaggatttttcagcgtccgaagattcttag

DBGET integrated database retrieval system