KEGG   Candida tropicalis: CTRG_00936Help
Entry
CTRG_00936        CDS       T01115                                 

Definition
similar to potential histone acetyltransferase Sas3
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CTRG_00936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 769 aa AA seqDB search
MGSQLLKQLKITNNHIYSNIVPKDLDKRTIRVKPINDYSLKNMLKNTRLPVVSSTVAGIS
KPAKRARNSRVKIKMRKRKCWITIKYDKKLGVSLLNTPIDTILKHQNCTDDDDDASNGFR
IQDEDKEDSLEDRQLPYNGILKYPDCIINNTDPTKEDKDQFNQFLKEGVLLRNKTLNQST
SEENQPQKEDSLPPSKNHLEPQQSAESTPAPNVLTLSKSKINRIVFRDYEINTWYIAPYP
EEYSQCEVLYICEHCLKYMNSPISYQRHQLKNCNFSNNHPPGLEIYRDIEKKISIWEVDG
RKNINYCQNLCLLAKLFLNSKTLYYDVEPFVFYILTEIDDNDFSKYHFVGYFSKEKLNSS
DYNVSCILTLPIYQRKGYGNLLIDFSYLLSRNEFKYGTPEKPLSDLGLLSYRNYWRITIA
YKLREIHEKYLKHSSNQKPISLSIDVLCKLTGMIPSDVIVGLEQLDSLMRNPITHKYAIT
INVQKVNEEIEKWEKKSYTTLRYENLLWKPMLFGPSGGINSAPAIPQEQQQQFQQNKAAP
TVSQNSISLITNFLKDDINNPYTFEEEGFKEIEMYLSTENEDIISESIVEYVPCYPGIGC
KKKPHANGNIKNFVIEDDLDEDVIKVDSTDDDEPDFQEYDEYEEEEEEEEIELQDDDESD
DDDPSEEDEEEEHEQEQEIIEIKDDSSDEDVSPEIIDLESDDFDDIDWNRRAPPPPPPKR
KTIDVLAGDNRPRGRGRPKGTFKIRTPVVAKPLPKLEPRRSTLRRAKQK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgggactgcaactactaaagcagttgaagataactaataatcatatatattctaatatt
gtccctaaggatctagataaacgaacaataagggtgaaaccaataaatgattattctttg
aaaaatatgttaaagaacacccgtttaccggttgtttctagcacagttgcaggaatatcg
aagccagcgaaacgggcaaggaattctcgtgtgaaaataaagatgagaaagaggaaatgt
tggattactataaaatatgacaaaaaattgggagtatcgctactaaacactccaatagat
actattcttaagcatcaaaattgtactgatgatgatgatgatgcttcaaatgggtttcga
atacaagatgaagacaaagaggattcgttggaagatagacaattaccgtataatggaata
ttgaaataccctgattgtataattaataatactgatccgacaaaagaagataaggatcag
tttaatcaatttctcaaagaaggtgttttgttacgaaacaagacattaaatcaatccaca
tcagaggaaaaccaaccacaaaaagaagattccctacctccttccaaaaatcatctcgaa
ccacaacaaagtgcagagtcaacacctgcaccaaatgtattaacactaagtaaatcaaaa
atcaatcgcattgtgtttcgagattatgaaatcaatacttggtatattgcaccatatccc
gaggagtattcccaatgtgaagttttgtacatttgtgaacattgtttgaaatacatgaat
tctcctatatcttatcaaagacatcaattgaaaaattgtaatttttcaaataatcatcca
cccgggttggaaatttatcgagatatagagaagaaaattctgatttgggaagttgatggt
aggaaaaacattaactattgtcaaaatttatgtttactagccaaattatttttgaattcc
aagactttatattatgatgttgagccatttgttttttatattttgacagaaattgacgat
aatgatttttcgaaatatcattttgtggggtatttttctaaagaaaaattgaatagttcc
gattataatgtttcttgtattttaaccttgcctatatatcaaagaaaaggatatggtaat
ttattaattgattttagttatttattgagtcgaaatgaatttaaatacggaactcccgaa
aaaccattaagtgatttgggtttattaagttatagaaattattggaggatcactattgct
tacaagttacgagaaattcatgaaaaatacttgaaacactcatcgaaccaaaaacccatt
tcattatcaattgatgtgttgtgtaaattaacaggaatgatcccgtcagatgtaatcgtt
ggtttggagcaattggattctttaatgagaaacccgataactcacaaatatgcaattaca
ataaatgtacaaaaggttaatgaagagattgaaaaatgggaaaaaaagtcatataccaca
ttgagatatgaaaatctattatggaaaccaatgttatttggtccaagtggtggtataaat
tcagcacctgcaattcctcaagaacaacaacaacaatttcaacagaataaagccgctcca
acggtatcacagaatagtatttcactaattacaaatttcttgaaagatgatattaataat
ccgtatacttttgaagaagagggatttaaagaaattgaaatgtatctactgacagagaac
gaagatattatcagtgaaagcattgttgaatatgttccttgctaccctggtattggatgc
aaaaagaaacctcatgcaaacggtaatataaagaactttgttattgaagatgatctagat
gaagatgtgataaaggtagattcgactgatgacgatgaaccagatttccaagaatatgat
gaatatgaggaggaggaggaagaagaagagattgaattacaagatgacgacgaaagtgat
gatgatgatccatcagaagaagacgaagaggaggaacatgaacaagaacaagaaatcatt
gaaataaaggacgactcgtccgatgaagatgtttccccagaaattattgatcttgaatct
gatgattttgatgatattgattggaatagacgtgcaccacctcctcctccaccaaagaga
aaaacaatagatgttttagcaggtgacaatagaccaagaggtagaggcagacctaaagga
acgtttaaaataagaacacctgtagttgcaaaacctttgcctaaacttgaacctagaaga
agtactcttagaagagccaaacaaaaataa

DBGET integrated database retrieval system