KEGG   Candida tropicalis: CTRG_00962Help
Entry
CTRG_00962        CDS       T01115                                 

Definition
similar to potential anaphase promoting complex TPR repeat subunit Cdc27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ctp  Candida tropicalis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CTRG_00962
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CTRG_00962
   04113 Meiosis - yeast
    CTRG_00962
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CTRG_00962
Ubiquitin system [BR:ctp04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CTRG_00962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 804 aa AA seqDB search
MQSTTSNTGGGSNNNNNYLHEDPSTPSSDPEANPKYIQQYLRSVIIHSLDTLNYKNAEFA
SERLIAIIEADQQQQQQQSPDLQQESEEMLDSIYLYCLVLFKQDRFKTCYYKLNNLKKFD
YHLGCSFLYGKCCLKLGKFKEGLFHLIKTKKIHEINGSKQHHHHHHHSNHHHQQQGNNRY
SRFNYEFNRSINPDISIIYHLLGDLYREIHDVKNSCVNYTQALRINQFDFEAFQELCKLG
VNIRVKSIFKFQNQPNNNNSNSNTSVNLGNGISLTTTSNTNNDGSMIPDLTNPFNDKNLN
SKMMTPSIHVDEFNFSTPRIKNPSIPDAPLRKSNLNNTGMTSSGGGVGGSNSLNNNNLDF
EFAKPSYPDDRRKSTSGGNTYSRITSRLISQPQPNHQHQGHHNQQQPPSSSSSSAQVRQQ
STTQSAVETPKKRNLKRNNSATLEAVHQPTTSSSSSTVASNPSSSNSSIIITKEIEKSEK
YLLQLYQILGKSFRSMSKYDCYKAIRILETSLSNQEKQTPWVLSKLGRLHYEIVNYPQSE
YYFNKLRKLDRTRLEDMEYFSTLLWHLNKKVELTYLANELHDLNPNSAITWCTIGNLFSL
THEPDEAIKCFNRAIKLDKSFTYAYTLKGHEYFSNDNYEMALENFRISLVLDPRHYNALY
GIGMVYINLGDYEKADYHFRKAISINPINIILICCCGMVLEKLNKKNLAIKQYELANKLQ
PLNPLPIFKLGQLYFSLQQYNQALKNFEILKNLAPDEASVHFLLGQLYNLQNDKFSAIKE
FTIALNLDPKGNYLIREAMESLKS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaacgactagtaatacaggaggaggaagtaataataataataattatctccat
gaagatccttcaactccttcaagtgatccagaggcaaatccaaaatatatccaacaatat
ttacgatcagttattattcattctttagatactttgaattataaaaatgctgaatttgca
agtgaaagattaatagcaataattgaagcagatcaacaacaacaacaacaacaactgcct
gatttacaacaagaaagtgaagaaatgttggattcgatatatttatattgtcttgtttta
tttaaacaggatagatttaaaacatgttattataaattgaataatttgaaaaaatttgac
tatcatttaggttgttcatttctatatgggaaatgttgtttaaaattgggaaagtttaaa
gaggggttatttcatttaattaaaaccaaaaaaattcatgaaattaatggttcaaaacaa
catcatcaccatcaccatcatagtaatcatcatcatcaacaacagggcaataatcgctat
ctgagatttaattatgaatttaataggagtataaatcctgatatttctattatttatcat
ttattgggagatttatatcgtgagattcatgatgtgaaaaatagttgtgttaattatact
caagcattaagaattaatcaatttgatttcgaagcttttcaagaattatgtaaattgggt
gtcaatattcgagttaaatcaattttcaaatttcaaaatcaacctaataataataatagt
aatagtaatacaagtgttaatttaggtaatggaatttcattaactacgacatctaataca
aataatgatggttcaatgattcccgatttaactaatccatttaatgataagaatttaaat
tctaaaatgatgactccttcaatacatgttgatgaatttaatttttcaactccaagaatt
aaaaatccaagtataccagatgcaccattaagaaaatcaaatttgaataatactggaatg
actagctccggcgggggtgttgggggatcaaattcattgaataataataatttagatttt
gaatttgctaaaccttcatatcctgatgatagaaggaaaagcacaagtggaggaaacact
tattcaaggataacatcgaggttaatttcacaaccgcaacctaatcatcaacatcaagga
caccataatcaacaacaaccgccatcatcttcctcatcttcagcacaagtacgacaacaa
tctacaacacaaagtgctgttgagacgcctaagaagagaaacttgaagagaaataattca
gccactttggaagcagtacatcaaccaactacatcttcgtctagctcaacggtagcatct
aacccatcttcatctaattcatcaattataataactaaagaaattgaaaaaagtgagaaa
tatttattacaattgtatcaaattttggggaaaagttttcgaagtatgagcaaatatgat
tgttataaagcaattaggatattagaaacatcacttagtaatcaagagaaacaaacacct
tgggtattgagtaaattaggtcgattacattatgaaattgtcaattatcctcaatccgaa
tattattttaataaattgagaaaattagatagaacaagattggaagatatggaatatttc
ctgacattattatggcacttgaataaaaaagttgagttgacatatttagccaatgaattg
catgatttgaatccaaattcagctatcacttggtgtactattggaaatttattttcatta
actcatgaaccagatgaagccattaaatgttttaatcgtgccattaaattagataaaagt
ttcacatatgcttatactttgaaagggcatgaatatttcagtaacgataattatgagatg
gcattggagaatttccgaattagtttagttttggatccacgtcattataatgcgttatat
ggtattggtatggtttatataaatcttggagattatgaaaaagccgattatcatttccgt
aaagcaatttcaattaatccaattaatattatattaatttgctgttgtggtatggtttta
gaaaaattgaataagaaaaatttagcaattaagcaatatgaattggcaaataaattgcaa
ccattaaacccattgcctatatttaaattgggacaattatattttagtctacaacaatat
aatcaagcattgaaaaattttgaaattttgaaaaatctagcaccagatgaagcaagtgtt
catttcttattgggacaattgtataatttacaaaatgataagtttctggccattaaagaa
tttacaattgctttgaatttagatccaaaaggtaattatctaatcagagaagcaatggaa
tcattgaaaagttaa

DBGET integrated database retrieval system