KEGG   Candida tropicalis: CTRG_01057Help
Entry
CTRG_01057        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ctp  Candida tropicalis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ctp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 817 aa AA seqDB search
MGIGTSMSLALTTPKTIFDFIYHPKNLGTHGAVDFYEIMLFHLSSVVQIALYVGCENKIS
LKAISILKGIGKSKFFITKVSSSSAPLLNNDRLITTFQNIDESVKIQYAFIDKFEELEDT
LDLRFKILEFLLENLNQSDGRVATVAHFLLGYKIRGDILDLNNDPDKNTLLKSLLSTLNV
SLELISEIDYNNGNNHIIDVGPAKLSSLILEILIKLSKDHISSLVTLNRLREYDQLFERL
VNCQPKLDLNTLWCGHAFNGDLQSDISNYFIEDQLSTQTFFSFINQRNLILQYLSLEFHS
VKSMTKKEYYVNILTNDKEFLNRSPKVLSFLNILNYSFKNFEVQKFEWLDRKFNMPLILE
EANKNKNGTLDFSVMNKVFRILCQASSLATPESRQLFAEEIMVEGSKISEFVAKYSVSTD
LKEIQLKCLHSWCQLIEILITDSGLDSSEFILEVLQVILPKVNDYYDADISFSEELVSLC
VLLFDLYDQSALANKKGEEFTLSIERLISLFQTCIAGILNSNSAPNLRSDLYVVGNKFLL
KCIANESFLKQMVTIIRSVDKKFFQVICNDAIFSEGSSRITSTLFLESLVHLGTLTNVDF
ILKALTKNNALSLLVRSVKRTDAMLSLCQGKNSGVTLENLVFDLTAFRATLYFFIRVAKT
KNGSLQLIQNELFSILKQSNFLQIDPDLGLNLNIEEVSDHKTIKINVLLDTPLSLLDMVD
ASKLKSENTISYFEFLIPIFQLIATVLLSMGPNYQPARIQTRELMKGINRLVVGVLKRDL
LVEDKKVGKELYKENSSELELLKEMVKLFTLIDSLVN
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgggaattggtacttccatgagtctcgcattgaccactccaaagactatctttgatttt
atctatcatccaaagaatcttggaactcatggtgcggttgatttttatgagattatgtta
ttccatttatcaagcgttgttcaaattgcactttatgtgggttgtgagaacaaaatttcc
cttaaagctatttctattttgaaaggaatcggaaagtctaagttctttatcaccaaagtt
tctagttccagtgcaccattattaaataatgatcgtttaattactaccttccagaatatc
gatgaatctgttaaaattcagtatgccttcattgacaaatttgaagaattggaggacact
ttggacttgagatttaagatcctagagtttttgttagaaaatcttaatcaatcagatggg
cgtgttgctactgttgcgcactttttgttgggatacaagataagaggtgatatattagat
ttgaataatgatccggacaaaaatacccttttgaaatctttgttgagtactctaaatgtc
agtcttgagttgatatctgaaattgattacaacaatggtaataatcatatcatagatgtt
ggtccagcaaaactttcttctttgattttggaaatccttatcaagttgagcaaggatcat
atatcatcattggttacattaaatcgattacgtgaatacgatcaattgtttgaaagatta
gttaattgtcagccaaagcttgatttgaacactttgtggtgtggccacgcatttaacgga
gatttacaaagtgatatcagcaattacttcattgaagatcaattgagtacacagacgttc
ttctcgtttattaatcagagaaatttaatattgcaatatttgtcattggaatttcacagt
gtaaaatcgatgaccaagaaagagtattacgttaatatcttgaccaacgataaagaattc
ttgaatcgttccccaaaagtgttgagttttttgaacattttgaattattcgttcaaaaac
tttgaagtacagaagtttgagtggttggaccgcaagttcaacatgcctttgattttggaa
gaagctaataagaacaagaatggtactttggactttagtgtgatgaacaaagttttcaga
attttgtgccaagcttctagtttagcaacccctgagtcgagacaattatttgccgaggaa
attatggttgaaggtagcaaaatttcagaatttgtggcaaaatacctggtttccacggat
ttgaaagaaatccaattgaagtgtttgcattcttggtgtcagttgattgagattttaatt
actgatagtggattggattcctctgagtttattttggaagttcttcaagttattcttcca
aaagtcaatgattattatgatgcggatattctgttttctgaagagttggtatcactttgt
gtattgttattcgacttgtatgaccaactggcgcttgcaaataagaagggtgaagagttt
actttgtcaatcgaaagattgatttctttgttccaaacctgtattgctggtattctcaac
tcaaattctgctcctaacttaagatctgacttgtatgttgtgggtaataagtttttgttg
aaatgcattgccaatgaatcatttttgaagcaaatggttactattatcaggtcggtagat
aagaaatttttccaagttatttgtaacgacgcaatcttttccgaaggttcatctagaatt
acttcgactttatttttggaatcattggttcatttgggtacattgactaatgttgatttt
atcttgaaagcacttaccaagaataatgcgttgctgttgcttgttagatctgtcaagaga
actgatgccatgcttagcttgtgccaaggaaagaattccggtgtcactttagagaacttg
gtatttgatttgactgctttccgagccacgttatatttttttattagagtggccaaaacc
aagaatggttctttacagttgattcaaaatgaattgttttcaattttaaagcaatcaaac
tttttgcaaatcgacccagatttagggttgaatttgaacattgaagaagtaagtgatcat
aaaacaatcaaaatcaatgttttattagacactccactttcattgttggatatggttgat
gctagcaagttgaaaagcgagaatacaatttcatactttgaatttcttatacctattttc
caattgattgcaacggtgttgttatcaatgggaccaaattaccaaccagctagaatccaa
acgagagagcttatgaaaggtattaaccgtttagttgttggtgttttgaagagagatctt
ttggtagaggacaagaaagttggtaaagaattgtacaaagaaaacagttccgagttggaa
ttattgaaggaaatggttaaattgtttacattgattgattctttagtaaattga

DBGET integrated database retrieval system