KEGG   Candida tropicalis: CTRG_01063Help
Entry
CTRG_01063        CDS       T01115                                 

Definition
similar to potential glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctp  Candida tropicalis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CTRG_01063
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CTRG_01063
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CTRG_01063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 882 aa AA seqDB search
MTKFYAGQFLCGGFQGTSVTPQAYHLIVEHHVSTMILSRKNAVSVEQMSKLIRDLQYIAM
TQGRYEHPLMFAIDEEGGMSNALFDPDFLTQYPGAMALAATGDPTLVYEISKAVGIELKK
IGFSIILGPVLDVVTKFSHQLVGVRSFGTTIEDVTKYGGMCAKGLQDAGLFTVGKHFPGI
GNAAVDSLLELPMIGDSLDQLRHFNIRPFANLIQQGLLDGISAAGCGVPNISPDETHACL
SPIVINQLLRNELQFDGLVLSECLEMETLYHSFGLEQGVILALNAGCDLVMVCHDWELQN
QAIESIRKAIVNFPSDTLLSSYKRIERLQERLPRWSEIFPEGELSAKQPPTLFRNEYPDL
WEEHQKLSSSAYQKSITLVRDFNGALPISNYLSDGEEVDSILLLTPLLYPIYPCETVDKT
NSRLHTGEEVFQKFGDFLSDHPIRQEKKYNVLHTTYTANGLTPLHESLIEQSKVVIVVTS
EASRNMHQIGLVKFISLLCGASPSTLNRNGVNGNVPPPQSTKPLIIVATQSPYDFFYNKS
IGSAYLCCYDYTPNALSKLASVLMGDYEPEGCVPGEKKFMLRTKPESPSRLSHNNNTPRR
RWLVDELDWQRDGESIIKLFKSNFDRRGNKIDYQDDRFYKRLSGFFVTMRRTQKSFVVRN
SSLNIVLGFILTFVTETDGVRSGRIIMVLVDKSKRCQNIGKCLHSRAMKYFKEVNCSEIY
LGSRGLPLIYFDDISSSTVSFFNSVGWTINRSAKRYVMVLNELGEPPELPDNYIFDRTPD
KIVARDRFTNQVVASVTTFTSNSQLSKYFPFIDSIRNDQGTIGGLIGFTGDKNAKHGLVS
SAITYFGSAVDAIMMIESDHSLECLGFEEWAWYYDYYGRKDV
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattttatgctggtcagttcttgtgtgggggctttcaaggtacctcagtcact
cctcaggcttatcatctaatagtcgagcatcatgtgtcaacgatgattttgtcacgtaag
aatgctgttagtgtggagcaaatgtccaaacttattcgcgatcttcaatacatcgccatg
acacagggacgatatgaacatcctttaatgtttgctattgatgaagaaggtggtatgagc
aatgcattatttgatccagatttcttgacccaataccctggtgcaatggcgctagctgct
acaggcgatccaacattggtttacgaaatactgaaagctgttggtattgaacttaaaaag
attggattttccattatattgggaccagttctagacgttgtgacaaaattttctcaccag
ttggttggggttagaagttttggaaccactatcgaagatgttacaaaatatggaggaatg
tgtgctaaagggttacaggatgcgggtttgtttactgttggaaagcatttcccggggatt
gggaatgctgctgttgattcgttattagaattaccaatgattggtgattctttggaccaa
ttgagacattttaatattcgcccttttgcaaatctaatacagcaaggacttcttgatgga
atcagtgcggctggctgtggggttccaaatataagtccggacgaaacccatgcttgtctt
tcaccaatagtaattaatcagttattacgaaatgaattgcaatttgatggattagtactt
agtgaatgtttagaaatggaaacattatatcattcttttgggttagagcaaggtgtgatt
ttggcacttaatgcgggttgtgatttagtaatggtttgtcatgactgggaattgcaaaat
caagcgattgaaagtataagaaaagccattgtgaattttcctagtgatactttgttgtcc
agctacaagagaattgaaagattgcaagaacgattaccaagatggtccgagattttccca
gagggagagctttcagcaaaacaacctccaacattgttcaggaatgaatatcctgaccta
tgggaggaacatcaaaagttgtcgtcactggcttatcagaaatccattacgttggtgcgt
gatttcaatggtgcattacctatttccaactatttatctgatggagaagaagttgattcg
atactattattgacgccgttgttgtatcctatttacccatgtgaaacggttgataaaacg
aatagtagattacataccggtgaagaagtattccaaaagtttggtgattttctatcagac
catccaattcgacaggaaaagaagtataacgttcttcacacgacctacacagctaatgga
ttgactccgttacatgaatcattgattgagcaatcgaaagtcgtgattgtcgtgaccagt
gaagcttcaagaaatatgcaccaaattggacttgtcaaatttatatcattgttatgtggt
gcaagcccatcaacattaaaccgaaatggggttaatggcaatgttccacctccacaatct
actaaaccattgataatcgtggcgactcaatcgccgtatgattttttctataacaaatcg
attggtagtgcctacttgtgttgttatgattacacccccaacgcgttatccaaattggcg
ctggtattgatgggagattacgagccagaaggatgtgttcctggagagaaaaagttcatg
ttaagaaccaaacctgaactgccaagtagattgtcccataacaacaacacaccaagacga
cgttggttggtggatgagcttgattggcaaagagatggggaatcaataatcaagttgttc
aagtcgaattttgacagaagaggaaacaagatcgactatcaagatgacagattctacaag
cgtcttagtggttttttcgttactatgaggagaacacaaaagagttttgtggtgagaaat
tcttcgttgaacattgtattggggtttattttgacgtttgtcacggagacagatggtgtt
agaagcggaagaattatcatggttttagttgacaagtctaagcgttgtcaaaacattggg
aaatgtttgcattctcgagctatgaaatatttcaaggaggtaaactgtagtgaaatttat
ttagggagccgtggtttaccattgatctattttgatgatatttcaagctccacggtgtct
tttttcaacagtgttggatggactatcaatcgatctgccaagagatacgtcatggttttg
aacgaattgggtgaaccaccagaacttcccgataattatattttcgatagaactcctgat
aaaatagttgccagagacaggttcacgaatcaagttgttgcttctgtcactacatttacg
agtaactctcaacttagtaaatatttcccatttattgattccatcagaaatgatcaaggc
acaattggtggtttgattggttttactggtgataagaatgctaaacatggattagtttct
agtgcaattacctattttggatctgctgtagatgctattatgatgattgaatcagatcat
tcgttggagtgccttggattcgaagaatgggcatggtattatgattattatggaagaaaa
gacgtttag

DBGET integrated database retrieval system