KEGG   Candida tropicalis: CTRG_01093Help
Entry
CTRG_01093        CDS       T01115                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ctp  Candida tropicalis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ctp00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MQSELYSSTYGKANVKFLKVKKDQSNPTVQEILEANVQVLLRGKFEESYTKADNSSIVPT
DTVKNTILVEAKNTDVWPIERFAAHLAKHFTSKYGHVEGIEVTIVQSKWSKIQLNGKEHA
HSFRYDGPETRRTFLNYDKLTKKLQLTSSIKDLTVLKSTGSMFYGYNVCDYTTLQPTKDR
ILSTDVDASWTFDPTQISTLDDILSQPKLFDTTYDAARDVTLELFCLENSPSVQATMYNM
AHKILEQVKQVGIVTYILPNKHYILFNLEWKGIKDNKELFYPSSDPNGLIKCTVGRKGDK
AKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgaattatattcatccacttacggtaaagctaacgtcaaatttttaaaggtc
aagaaagatcaatccaacccaactgttcaagaaattcttgaggccaatgtccaagttttg
ttaagaggtaaatttgaagaatcatacaccaaggctgataactcatcaattgttccaact
gatacggtgaaaaacactattttggtagaagctaagaatactgatgtttggccaattgaa
agatttgctgctcatttagctaaacatttcacttccaaatatggtcatgttgaaggcatt
gaagttaccattgttcaatctaaatggtccaagatccaattgaatggtaaagagcacgcc
cattcttttagatatgatggtccagaaacccgtcgtacgtttttaaactacgataaactc
accaagaaattacaattaacttcatcaatcaaagatttaactgttttgaaatccactggg
tcaatgttttacggatacaatgtttgtgattacaccacattacaaccaaccaaggataga
attttatctactgatgttgatgctagttggacttttgatccaacccaaatttccaccttg
gatgatattttgtctcaaccaaagttgttcgatactacttatgatgctgctagagatgtc
actttagaattgttttgtttagaaaattctccttcagttcaagcaaccatgtataatatg
gctcataagatcttggaacaagtcaaacaagttggcattgttacttacattttaccaaat
aaacattatattttgtttaacttagaatggaaaggtattaaagataacaaggaattgttc
tatccatcttcagatccaaatggattgattaaatgtactgttggaagaaaaggagataaa
gctaagttttag

DBGET integrated database retrieval system