KEGG   Candida tropicalis: CTRG_01114Help
Entry
CTRG_01114        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MFDTTDNPITSPKRKKARNKDTEDNSYYGQLNKRNINKVTFGNYEFSAWYGNAAYFHPHD
LSHSSLGYVYANKVAMEGSGARKIHKKDMFDETLHEFWLDHLYVCEYCFKYSSQEHELNL
HVAKCQQNRTRPNLGKLMYRDQKNGYIIREIRGFQNPLFCQNLCLFGKLFLDDKSIYYNI
DHFNFYIIYGKDDYSTNYIPMGFFSKEVLSYENDINLACICVFPPFQRRHLGSLLIDFSY
QLARVTPGQYYGSGPEYPLSPYGKMTYLRYWSKRIVRVIDESQESFTLNDLSRLTGFRKE
DILLSLEFMGVLVSDSTTGDVSLCIDNLKHWKKENHYDPYKELDALDTSCLII
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacaacagacaatccaatcacttctccaaaacgaaaaaaagccagaaacaag
gatacagaagataattcttattatggacaattaaacaaacgaaatataaacaaagtgact
tttggaaattacgaattttcagcgtggtacggcaatgcagcgtatttccatccccatgat
ttatctcattctagtttgggatacgtatacgctaataaggtagccatggaaggatctggg
gctagaaagatacataaaaaagacatgtttgatgaaactttacacgaattttggttggac
catttatacgtttgcgaatattgtttcaaatactcatctcaagaacacgaattaaatttg
catgtggccaagtgtcagcaaaataggacaagacctaatttgggaaaattaatgtacaga
gatcagaagaatggttatattattagagagattcgagggttccaaaatccattgttttgc
cagaatctatgtttgtttgggaaattgtttcttgacgataagtctatctactataacatt
gatcattttaatttctacattatctacggaaaggatgattactcgacgaactatatacca
atgggttttttctccaaggaagtattgtcgtatgaaaacgatataaatttggcatgcata
tgtgttttcccgccgttccaaagaagacatttggggtcattgttgattgatttcctgtat
caacttgcacgagttacaccaggccagtattatggtagtgggcccgaatatccgctttcc
ccatatggaaaaatgacatatttgcgatattggtccaaaagaatagtaagagtaattgat
gagtcgcaagagagctttacattaaatgatttgtcaaggcttactgggtttagaaaagaa
gatatactactatcgttggaatttatgggtgtattggttagtgatagcacaacaggcgat
gtttctctttgtattgataacttgaaacattggaagaaagagaatcattacgatccatat
aaagaattggatgccttagataccagttgtctaattatatga

DBGET integrated database retrieval system