KEGG   Candida tropicalis: CTRG_01163Help
Entry
CTRG_01163        CDS       T01115                                 

Definition
similar to ubiquitin carboxyl-terminal hydrolase
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 741 aa AA seqDB search
MGHLQTSNLPYGDGSHKIFGMENFGNTCYCNSILQCLYYTENFRTQLIQHNSTKHEPKLI
VAGYKPHNFTSKYEQLVQKKLKEQGGKSTSISSPTQDERPKPASRRGSLFGLKFNNNNSS
ASAVASGNSTSISVVIEDPKKKYGKYISLAKDCEALSLEQRIKICKSPEFQKLDILITRP
IDTQANKESSSDKDDRNDYSQSSSMLLNDQPQQTTQEGSISTTSSAIIVGIPHPESNLAV
PINPFNANPSGDQRKRSALINGPIINLDLPLQTPSEINEDTALLYALRDLFESMVENKST
IGVVSPSYFIQKLKEKNFLFRQNNMHHDAHEFFNYLINEIIESVNKEDKGDGINWCSDIF
RGLITNETKCLSCETVTSKQELFLDLSVDIPPGESSFSLTYALNNFSKSETLTNQNKFYC
NTCSSLQEAVKTIKLKKLPKVLVINLKRFKYDEEMDKMVKLFDSISYPFKLRLFNTTDDE
SLQDQLYELYALVIHIGGGPMHGHYVSICKIKAGLWLLFDDETVELVEDSYVMRFFGDGP
GLASAYILFYRQGNYNTEFGFDTEDIYNGADECSMKHGEDESSTLATSVNNNDQIDPISD
ASSITSFNASEASKRPGLLKSFTFDKEEKFQNPLSRTTSRGHMPTPPPAAVVTGPLDVPE
PYIPQQQQQQQQQQQQQQGFPLAPSKEVKEKKSWVGSLKRRKDESGSSNNSGAPPIERKA
STSSAVSGSERRRSIFGFKRK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgggacatttacaaactagcaatcttccatatggtgatggatctcataagatttttggc
atggagaactttggaaacacatgctattgtaattccattctccagtgcttgtattacacc
gaaaattttagaactcaattaatccaacacaatctgacaaagcatgaaccaaaattaatt
gtcgccggttataagcctcacaactttacatcaaagtatgaacaattagtgcaaaagaag
ttgaaggaacaaggtgggaagtcaacatcaatctcctccccaactcaagacgagcgtcca
aaacctgcaagtagaagaggttcactttttggtctcaagtttaataacaacaattcatct
gctagtgcagttgcttcagggaattctacttctatatctgtggtgattgaagaccccaaa
aagaagtatggcaagtatatttcacttgcaaaggattgcgaagctttgtcgttggaacaa
aggatcaaaatttgtaagtcacccgagtttcaaaaattggacattcttatcactagaccg
atagatacccaggccaataaggagtcatcatcagacaaagatgacagaaatgactattcc
caaagttcgtcaatgttactcaatgatcaaccacaacagacaacacaagaaggatcaatc
agtacaacttctagtgcaattattgttggcatacctcaccctgaatccaacttagcagtt
cccatcaatccatttaatgccaatccaagtggtgatcaaagaaagagatcagctttgatt
aatggacctatcatcaacctcgatctaccattacaaacaccaagtgaaatcaacgaggat
acagcattattatatgctttgcgagatttatttgaaagtatggttgaaaacaagtcaact
attggtgttgtttctccaagttattttattcaaaagcttaaggaaaagaattttcttttc
cgtcaaaacaacatgcatcatgatgctcatgagtttttcaattatttgatcaatgaaatt
attgaaagtgtcaacaaagaagacaagggagatggaattaactggtgtagtgatattttc
cgtggattgatcaccaatgaaactaaatgcttgtcatgtgagacagttacttcgaagcaa
gaattattcttagacttgtcagttgatatacctcctggtgaaagtagtttttccttgact
tatgcattgaacaacttttccaagtctgaaaccttgacaaatcaaaacaagttttattgt
aacacttgttcgtcgttacaagaagcagtgaaaaccatcaagcttaagaaactaccaaaa
gtgttggtaataaatcttaagagattcaagtatgatgaagaaatggataaaatggtgaag
ctttttgattcaatcagttatccattcaagttgcgtttgtttaacactaccgatgatgaa
tctttacaagaccagttatatgaattatatgcattagtgatccacattggaggaggccca
atgcatggacattatgtttccatttgtaaaataaaggcaggactatggttgttgtttgat
gacgagacagtggaattggttgaagattcatatgtaatgagattttttggcgatggccca
ggtttggcaagtgcttatattttattctacagacaaggaaactacaatactgagtttgga
tttgacactgaagatatatacaatggtgctgatgaatgctcgatgaaacacggggaagat
gaatcaagtacacttgctacttcggtcaataataatgatcaaatcgacccaatttcggat
gcgtcgtcgattacttcattcaacgcttctgaagcaagcaagagaccagggttactcaag
agttttacatttgataaagaggagaaattccaaaatccactttcaagaacaaccagtcgt
ggccatatgccaactccaccaccagcagcagttgttactggaccattggacgttcctgag
ccatatattcctcaacaacaacaacaacagcaacagcaacagcagcaacaacaaggtttc
ccattggctccatccaaagaggtcaaagagaagaaatcatgggttggaagtttaaagaga
agaaaagatgaatcaggtagttccaacaattccggtgctcctccaattgaaagaaaagcg
tcaacaagtagtgctgtttctggtagtgaaagaagaagaagtatatttggatttaaacga
aagtaa

DBGET integrated database retrieval system