KEGG   Candida tropicalis: CTRG_01172Help
Entry
CTRG_01172        CDS       T01115                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ctp  Candida tropicalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTRG_01172
Enzymes [BR:ctp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CTRG_01172
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTRG_01172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MVHKAEFLPSTGNSISSVLQGGYNHPLSREWQQDKQLTKNMFILPLFITDSPDEETEIPS
LPNIKRYGINKLIPYVKTLVDKGLRAVILFGVPLKEGVKDHLGTAADDPEGPVIQAIIKL
KENFPDLFIMCDVCLCEYTDHGHCGILNPDGSLKRDESVQRIAAVAVNYAKAGAHCVAPS
DMMDGRIRDIKMGLMNVGLENKCLVMSYAAKFSGNLYGPFRDAAGSKPSHGDRKAYQLPP
GGAGLARRALLRDMEEGADAVMIKPSTFYLDIISDAAKLCRDYPICAYHVSGEYAMLHAA
AEKGVVDLKSIAFEAHQGFLRAGARLIISYFTPEFLDWLQM
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtccataaagcagaatttcttccatcaactggaaactctatttcttcagtattacaa
ggtggttataaccatccattatccagagaatggcaacaagataaacagttgactaaaaat
atgttcatcttaccattatttatcactgattcaccggatgaagaaactgaaatcccatca
ttaccaaatattaaacgttatggtattaacaaattaattccatatgttaaaactttggtt
gataaaggattacgtgcagttatattatttggagttcctttaaaagaaggtgttaaagat
catttaggtactgcagctgatgatccagaaggtccagttattcaagcaattattaaatta
aaagaaaatttcccagatttattcatcatgtgtgatgtttgtctttgtgaatatactgat
catggacattgtgggattttaaatcctgatggatctttgaaaagagatgaatcagttcaa
agaattgctgctgttgcagttaattatgctaaagctggtgcacattgtgttgctccttca
gatatgatggatggtagaattagagatattaaaatgggtttaatgaatgttggattagaa
aataaatgtttagttatgtcttatgctgctaaattttctggtaatttatatggtcctttc
agagatgctgctggaagtaaaccaagtcatggtgatagaaaagcttatcaattaccacca
ggtggtgctggtttggctcgtcgtgctttattaagagatatggaagaaggtgctgatgct
gttatgattaaaccaagtactttctatttagatattattagtgatgctgctaaattatgt
cgtgattatccaatttgtgcttatcatgttagtggtgaatatgctatgttacatgcagct
gctgaaaaaggtgttgttgatttgaaaagtattgcatttgaagctcatcaaggttttttg
agagctggtgctagattgatcattagttatttcactcctgaattcttggactggttgcaa
atgtaa

DBGET integrated database retrieval system