KEGG   Candida tropicalis: CTRG_01175Help
Entry
CTRG_01175        CDS       T01115                                 

Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRG_01175
   01230 Biosynthesis of amino acids
    CTRG_01175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_01175
  Energy metabolism
   00680 Methane metabolism
    CTRG_01175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_01175
Enzymes [BR:ctp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTRG_01175
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTRG_01175
  Exosomal proteins of melanoma cells
   CTRG_01175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGEKEAKRAGELIKEAGINVDVLHTSKLSR
AIQTANIALSSADQLYVPVKRSWRLNERHYGALQGKDKAQTLETYGKEKFQIWRRSFDVP
PPDIDPKDEYSQVGDRRYNNIDPAVVPLAESLALVIDRLLPYWQDEVAGDLLAGKTVMIA
AHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKEAYYLDPEAAAAGAAA
VAAQGQKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttttagttagacacggtcaatccgaatggaatgaaaagaacttgttt
accggttgggttgatgttagattatccgaaactggtgaaaaagaagccaagagagccggt
gaattgatcaaagaagctggtatcaacgttgacgttttacacacttctaaattgtcaaga
gctattcaaaccgctaacattgctttgagttctgctgatcaattgtacgtcccagtcaag
agatcctggagattgaacgaaagacactacggtgctttgcaaggtaaagacaaggctcaa
actttggaaacctacggtaaagaaaaattccaaatctggagaagatcttttgatgttcca
cctccagatattgatccaaaagatgaatactctcaagttggtgacagaagatacaacaac
attgacccagctgttgttccattggctgaatctttggctttggtcattgacagattattg
ccatactggcaagacgaagtcgctggtgacttgttggccggtaaaaccgttatgattgct
gctcacggtaactccttgagagctttggttaaacacttggacaacatctccgatgaagat
attgctggtttgaacatcccaactggtatcccattggtttacgaattggacgaaaacttg
aaaccaaccaaggaagcttactacttggacccagaagctgctgctgccggtgccgctgct
gttgccgctcaaggtcaaaagaaataa

DBGET integrated database retrieval system