KEGG   Candida tropicalis: CTRG_01175Help
Entry
CTRG_01175        CDS       T01115                                 

Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00260  Glycine, serine and threonine metabolism
ctp00680  Methane metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
ctp01230  Biosynthesis of amino acids
Module
ctp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ctp_M00002  Glycolysis, core module involving three-carbon compounds
ctp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_01175
  Energy metabolism
   00680 Methane metabolism
    CTRG_01175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_01175
Enzymes [BR:ctp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTRG_01175
Membrane trafficking [BR:ctp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTRG_01175
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTRG_01175
  Exosomal proteins of melanoma cells
   CTRG_01175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 DUF4047
Motif
Other DBs
NCBI-GeneID: 8295900
NCBI-ProteinID: XP_002546870
UniProt: C5M5P5
Position
Unknown
AA seq 248 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGEKEAKRAGELIKEAGINVDVLHTSKLSR
AIQTANIALSSADQLYVPVKRSWRLNERHYGALQGKDKAQTLETYGKEKFQIWRRSFDVP
PPDIDPKDEYSQVGDRRYNNIDPAVVPLAESLALVIDRLLPYWQDEVAGDLLAGKTVMIA
AHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKEAYYLDPEAAAAGAAA
VAAQGQKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttttagttagacacggtcaatccgaatggaatgaaaagaacttgttt
accggttgggttgatgttagattatccgaaactggtgaaaaagaagccaagagagccggt
gaattgatcaaagaagctggtatcaacgttgacgttttacacacttctaaattgtcaaga
gctattcaaaccgctaacattgctttgagttctgctgatcaattgtacgtcccagtcaag
agatcctggagattgaacgaaagacactacggtgctttgcaaggtaaagacaaggctcaa
actttggaaacctacggtaaagaaaaattccaaatctggagaagatcttttgatgttcca
cctccagatattgatccaaaagatgaatactctcaagttggtgacagaagatacaacaac
attgacccagctgttgttccattggctgaatctttggctttggtcattgacagattattg
ccatactggcaagacgaagtcgctggtgacttgttggccggtaaaaccgttatgattgct
gctcacggtaactccttgagagctttggttaaacacttggacaacatctccgatgaagat
attgctggtttgaacatcccaactggtatcccattggtttacgaattggacgaaaacttg
aaaccaaccaaggaagcttactacttggacccagaagctgctgctgccggtgccgctgct
gttgccgctcaaggtcaaaagaaataa

DBGET integrated database retrieval system