KEGG   Candida tropicalis: CTRG_01181Help
Entry
CTRG_01181        CDS       T01115                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ctp  Candida tropicalis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CTRG_01181
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CTRG_01181
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CTRG_01181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 395 aa AA seqDB search
MSSDGEFTRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSAVDRLTGQNVAVKKIMKPFST
SVLAKRTYRELKLLKHLKHENLITLDDIFISPLEDIYFVNELQGTDLHRLLSSRPLEKQF
IQYFTYQILRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARLQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDIWSVGCILSEMIEGKPLFPGKDHVHQFSIITELLGSPPPDV
IDTICSENTLRFVQSLPHRDPIPFSERFASCTHVEPEAIDLLAKMLVFDPKKRISAAEAL
THPYMEPYHDPTDEPSCESKFDWSFNDADLPVDTWRVMMYSEILDFHQNVGSVSNNFDGA
EQQPVHTEDITGASAVASNGDQFQPQTQQPQEQKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggatggagaatttacaagaactcaaatctttggtacagtctttgaaataaca
aatagatataccgacctaaacccagttggtatgggtgcatttggtttggtgtgctctgct
gtcgatagattaactggccaaaatgttgccgttaaaaaaatcatgaaaccatttctgact
tcagtattagccaaaagaacatatagagaattgaaattattgaaacatttgaaacatgaa
aatttaattactttagatgatatttttatatctcctttagaagatatctattttgttaat
gaattgcaaggtactgatttacatagactattaagttcaagacctttggaaaaacaattt
atacaatattttacttatcaaatcttgagaggtttaaaatatattcattctgctggggtg
attcatcgtgatttgaaaccttctaatattttaattaatgaaaattgtgatttgaaaatt
tgtgattttggtttagcaagacttcaagatcctcaaatgactgggtatgtttcaactaga
tattatcgtgccccagaaattatgttgacatggcaaaaatatgacacagaagttgatatc
tggtcggtaggatgtatattgtcagaaatgattgaaggtaaaccattgtttccaggaaaa
gatcatgttcatcaattctccattataactgaattattaggttcccctccaccagatgtt
atcgataccatttgttccgaaaatactttaagatttgtccaatccttacctcacagagat
ccaattccatttagtgaaagatttgcttcatgtactcatgttgaaccagaagctattgat
ttattagctaagatgttggtgtttgatccaaaaaagagaattagtgctgccgaagccttg
actcatccatacatggaaccatatcatgatccaactgatgaaccttcatgtgagagtaaa
tttgattggagtttcaatgatgcagatttgccagtggatacttggagagttatgatgtat
agtgaaattttagatttccatcaaaatgttggcagtgtttcaaacaatttcgatggtgct
gaacaacaaccagttcatacagaagatattactggtgcttcagcagttgcatcaaatgga
gatcaattccaaccacaaacacaacaaccacaagagcaaaagatttag

DBGET integrated database retrieval system