KEGG   Candida tropicalis: CTRG_01230Help
Entry
CTRG_01230        CDS       T01115                                 

Definition
similar to phospholipase B3
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ctp  Candida tropicalis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ctp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 679 aa AA seqDB search
MHSLIYFAFLSISLVLASSPTNGYAPGIVQCPSDDSNLTFIREANSISDSEKEWISNRQL
KTNEALIEFLSSANLSDFNAEEFITSDDYQGINLGLAFSGGGYRAMLGSAGALMALDDRN
SFDTPLGGILQSANYISGLSGSSWLLGSLAMQNFTTVEEVVFENPYDLWNLTESRQLVNQ
TNLWKIILPVIGNNLTSALSFMNFWSNNKQGIKYDLAAKMMAGFETSLTDAWSRGLAHQL
FPQDDNNYGSSATWSDIRDSTAFANHDMPFMFVTALGRRPGTVVFNLNSTVIEMNPFEFG
SFDPSLNTFTDIKYLGTPVDNGKPVNACVNGFDNAGFVVGTSSSLFNSFMNTLVCDDCNS
LNFIVKIVLKKLLTYLSVTTEDVALYKPNPFYNSEFASSENITTNDTLYLIDGGIGGESI
PLSTLMVKQRELDVVLAFDYNTDTSTSWPDGSALISSYERQFAQQGSSSLCPYVPDSNTF
LQKGFTARPAFFGCDAKNLTDLMKDDVVPPLVVYFANRPYEYYSNVSTLSLTFTDEQKKG
LIQNGFDVASRLNNTIDPNFKSCISCAIIRREQERRGIEQSEQCKQCFEQYCWDGTYAED
KNPNYVNFTDSGLTNDTTVFYGGVNASVTSTSSSSSSGFLGLFKRDQQIAVISENSGDIV
GFSTSLSIVVLLVLLFEFI
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgcattcacttatttattttgctttcttgagcatttcattagtattagcctcatctcct
actaatggatatgccccaggtatagttcaatgtccctcagatgattcaaatcttacattt
atcagagaagccaattcaatttctgacctggaaaaagaatggatttcaaatagacaatta
aaaacaaatgaagcattaatcgaatttttaagttcagcaaatttaagtgatttcaatgct
gaagaatttattacttctgatgattatcaaggtattaatcttggattggcattttcagga
ggtggctatcgtgccatgttgggttctgcaggtgcattaatggcattagatgatagaaat
tcttttgatactccattaggtggtattttacaaagtgcaaattatatttctggattatct
ggaagttcatggttattgggatcattagcaatgcaaaattttactactgttgaagaagtt
gtttttgaaaacccatacgatttatggaatttaacagaatcaagacaattagttaatcaa
actaatttatggaaaattattttgccagtaattggaaataatttaactagtgctttaagt
tttatgaatttttggagtaataataaacaaggtatcaaatatgatttggctgctaaaatg
atggccggttttgaaacttcattgactgatgcttggtcaagaggtttagctcatcaatta
ttcccacaagatgataataattatggtagtagtgccacttggagtgacattagagattcc
acagcttttgctaaccatgatatgccattcatgtttgttactgctttaggaagacgtcca
ggtactgttgttttcaatttgaattccactgttattgaaatgaatccatttgaatttggt
tcttttgatccttctttaaatacttttacagatattaaatatttgggtactccagttgat
aatggtaagccagtaaatgcttgtgtcaatggttttgataatgcaggatttgttgttggt
acatcatcttcattattcaatctgtttatgaacactttggtttgtgatgattgtaattct
ttaaactttattgttaaaattgtgttgaagaaattattgacttacttatctgttaccact
gaagatgttgctctttataaaccaaatccattttataattctgaatttgctagttccgaa
aatatcaccactaatgatactttatatcttattgatggtggtattggaggagaatccatc
ccattatctaccttgatggttaaacaaagagaattagatgttgtacttgcttttgattac
aatactgatacttctactagttggccagatggaagtgcattgatttcaagttatgaacgt
caatttgctcaacaaggttcatcaagtctttgtccatatgttcctgattcaaatacattc
ttacaaaaaggattcacagcaagaccagcattttttggatgtgatgctaaaaacttgact
gatttaatgaaagatgacgttgttcctccattagttgtttattttgctaatagaccatat
gaatattattcaaatgttagtactctttccttgacttttactgatgaacagaaaaaagga
ttgattcaaaatggatttgatgttgcatcaagattgaataataccattgatccaaatttc
aaatcatgtattagttgtgctattattagaagagaacaagaaagaagaggaattgaacaa
ctggaacaatgtaaacaatgttttgaacaatattgttgggatggaacttatgctgaagat
aaaaatccaaattatgttaatttcaccgattctggtttgaccaacgatactactgtattc
tatggtggtgttaatgcatctgttacttcaactagtagtagtagttctagtggattttta
ggattattcaaaagagaccaacaaatagctgttatttcagaaaatagtggtgatattgtt
ggattttcaacttctttatcaatagttgtattactagtattattgtttgagtttatttag

DBGET integrated database retrieval system