KEGG   Candida tropicalis: CTRG_01426Help
Entry
CTRG_01426        CDS       T01115                                 

Definition
similar to ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CTRG_01426
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_01426
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CTRG_01426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 790 aa AA seqDB search
MTLELPSDISSTIPANAKIYKDDCMYSFDTPENNELGLDIDLKSYKAYSRNKDYNYTKEN
FEKTGNYLYLNIKKKLKPQEERNKLLYDDNGEKTPKLQKLEIKNVSDDDYYNSTITVYDV
RDDKVYQRNEVSESFNKLIDAILAANSSATEDEIKQWEQEIIPCHHSIDVEQFDNDNLDL
TKCSQCELAENLWICLHCGSLGCGRQQYGSDLKGNGHALAHYEISQHPVAIKLGSLSADS
ESCDAYCYQCNDEVKVPNLAEKLHKFGIDLNSAVKTEKSLVELNIDQNLNWDFKLDGANG
EKLPPVYGKGLTGFQNLGNSCYINSVLQSLYNLDGYKKYLKDEKFPPQVENPANDLISQL
IKIYDGLYSGRYSIPGSLKGDDYQLGIKPSAFKTLIGENHPEFKTQRQQDAFEFLLYFLD
KVDKELGLKLNEDLKFLLTSKVLCAHCSHGTLTNDLVDNISVPIEAEVLSKDEDGKKIYK
EVELIDSFREYTSEEAIEGYKCDNCDESPGMAFKSSGFKTFPKSLVVNVQRIKLENWAPI
KVDVPIEIPYELDLSEFTAPKFNDGEVEEAKKNESDTGASFVANEEALTTLLSMGFPEPR
CLKGLFNTGNNNAEDAMNWIFAHMDDADIDEPFDPNVNSSSSSASSNEPSAELIENVCAM
GFSQQLAKKALLLNNNDISAAVEWLFSNPDDNGVIEDNAKPVVNINEEKAKLIEKLEKST
CNNGKYELESVICHKGTSPHTGHYVVFIKKLIDGEYKWVLFNDEKVVVCDEDNLQDMKNS
AYVYIFKKIE
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaccttggaattgccttctgatattctgctgactattccagcaaatgccaagatctac
aaagatgattgtatgtactcattcgataccccagagaataatgagttgggattggacatt
gatttgaaatcatacaaggcatattcaagaaataaagattacaattatactaaagaaaac
tttgaaaaaacaggaaattatttatacttaaacattaaaaaaaaattgaaacctcaagag
gaaagaaataaattattatatgatgataatggcgaaaaaacccctaaattgcaaaaattg
gaaatcaaaaatgtatccgatgatgattattataattctacgatcactgtatatgatgtt
agagatgataaagtttatcaaagaaatgaagtgagtgaatcattcaacaagttaattgat
gctattcttgcggcaaattcctcagccacagaagatgagattaaacaatgggaacaagaa
attataccatgtcatcattcaatagatgttgaacaatttgataatgataatttagattta
actaaatgtagtcaatgtgaattggcggaaaatttatggatttgtttacattgtggaagt
ttaggttgtggtagacaacaatatggttctgatttgaaaggaaatggacatgcattagca
cattatgaaattagtcaacatccagtggctattaagttaggatctttatctgctgattca
gaaagttgtgatgcttattgttatcaatgtaatgatgaagttaaagtccctaatttggct
gaaaaattacacaagtttggtattgatttgaactcggctgtcaaaactgaaaaatcatta
gttgaacttaatattgatcaaaatttaaattgggatttcaaattggatggtgctaatgga
gaaaaattaccacctgtttatggtaaaggattgactggtttccagaatttgggtaattct
tgttatatcaattcagttcttcaatcactttacaatttggatggatataagaaatatctc
aaggatgaaaaatttccaccacaagttgaaaatccagctaatgatttaattagtcaattg
attaaaatttatgatggtttatatagtggtagatattccattcctggatcattaaaaggt
gatgattatcaattgggtattaaaccatctgcattcaaaactttaattggagaaaatcat
cctgaatttaaaactcagagacagcaagatgcttttgagtttttattgtatttccttgac
aaagtggataaagagttgggtcttaaactcaatgaagatttgaagtttttgttgaccagt
aaggtattgtgtgctcattgttcacatggtactttaactaatgatttggtggataacatc
tctgtgccaattgaagccgaggttttaagtaaagatgaagatgggaagaaaatttacaaa
gaagttgaattaattgatagttttagagaatacacttctgaagaagctattgaaggttat
aaatgtgataactgcgatgaatctccaggaatggcatttaaatcttcaggtttcaaaact
ttccccaaatcccttgttgttaatgttcaaagaattaaattggaaaattgggcaccaata
aaagttgatgttcctattgaaattccttatgaattagatttatctgaattcacagcacca
aaattcaatgacggtgaagttgaagaagcaaagaaaaatgaatcagacactggtgcttca
tttgttgctaatgaagaggcattaactacattattaagcatgggatttcctgaacctaga
tgtcttaaaggattgttcaatacaggaaacaataatgccgaggatgccatgaattggata
tttgctcacatggatgatgcagatattgatgaaccatttgatccaaatgtaaattcttct
tcttcttctgcttcatcaaatgaaccatcagctgaattgattgaaaatgtttgtgctatg
ggattttctcaacaattggctaaaaaagcattattattaaacaataacgatattagcgcg
gctgttgaatggttattttctaaccccgatgacaatggtgtcatcgaggacaatgcaaaa
ccggttgttaatattaatgaagagaaggcaaaattgattgaaaaattggaaaaatcaact
tgtaacaatggcaaatatgaattggagtctgttatttgtcataaaggtacatcaccacat
acaggtcattatgttgtgtttatcaagaagcttattgatggagagtataaatgggtattg
tttaatgatgaaaaagttgttgtttgcgatgaagacaacttgcaagatatgaagaacagt
gcttatgtttatatatttaaaaagatagagtag

DBGET integrated database retrieval system