KEGG   Candida tropicalis: CTRG_01530Help
Entry
CTRG_01530        CDS       T01115                                 

Definition
similar to map kinase kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ctp  Candida tropicalis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ctp04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MENNDSMNMDIDEELTTSMNNNNNTQQQVDSVEEVDSFSTKHHLEQLTPYDWHLLANSNK
IVEISKLGEGNGGSVSKCYLPDLLPNKQIFALKLIITDSNPDIQKQIFRELEVSRKCQHP
NIVKYYGTFLLEKQSMIGISMEYMDGKSLDSIYKEVLKRDKTNRINEKVLGKIANSILNG
LDYLHSKNIIHRDIKPSNILLDTKGNVKLCDFGVSGEAVNSFASTFVGTQYYMAPERITG
GNYSISSDIWSLGMSLLEVANGDFPIVSSLGPIEVVEMISRSHLELKDFEEDNIYWSNEF
KAFISKCLIKDYRRRPKPGDLLASDEWCLIQSKEKVRMDKFVKVVWELNE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatgattctatgaatatggatatagatgaagaattaacaacatctatgaat
aataataataatactcaacaacaagtggattcagttgaagaagttgatctgtttagtaca
aaacatcatttagaacaattaacaccttatgattggcatttgttggcaaattcaaataaa
atagttgaaattagtaaattaggagaaggtaatggaggttcagtttcgaaatgttattta
cctgatttattaccaaataaacaaatttttgcattaaaattaattataactgattcaaat
ccagatattcaaaaacaaatatttcgagaattggaagtttctagaaaatgtcaacatcca
aatatagttaaatattatggaacatttttattagaaaaacaatcaatgattggaatttca
atggaatatatggatggaaaatcattagatagtatttataaagaagttttaaaaagggat
aaaactaatagaataaatgaaaaggttttaggtaaaattgctaattcaattttaaatggt
ttagattatttgcatctgaaaaatatcattcatagagatattaaaccttcaaatatttta
ttagatactaaaggtaatgttaaattgtgtgattttggagttagtggagaagctgtgaat
tcatttgcttcaacatttgtgggaactcaatattatatggcacctgaaagaataacaggt
ggtaattattcaataagtagtgatatttggtcattaggtatgtcattattagaagttgct
aatggagatttcccaattgtttcatcattgggtcctattgaagtagttgaaatgattctg
agaagtcatttagaattaaaagattttgaagaagataatatttattggtcaaatgaattt
aaagcatttatttcaaaatgtttaattaaagattatagaagacgtccgaaaccaggtgat
ttattagcatctgatgaatggtgtttgattcaactgaaggaaaaagtaagaatggataaa
tttgttaaagttgtttgggaattaaatgaataa

DBGET integrated database retrieval system