KEGG   Candida tropicalis: CTRG_01613Help
Entry
CTRG_01613        CDS       T01115                                 

Definition
similar to MNB protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 726 aa AA seqDB search
MAYNNYNYNRHNSIGGSWHLPPPSYQQQQQQQQQQSQNPPHLQHQSSHPTLNQDVLGNPN
DQYQRPNQHMSGFRNPWYSQQQQQQQQASPSSSLLSSSSLSQSPTKSHQIPLLQQQQQPP
LNKRLSFANQLPTTYEYENDNNVPPFIHPPTRADNPFNQYFANQEVSLGSNDRRMSVAID
GTHYNPFGTFGQQNNAYPSGPAGVAGHQYLNNPNLGAIPGANRRSSLAVMPNHYRQQQGP
QQPIDPNSPAAAYYLPPARLGRSASIIQYQQYQQALQNSKVNKAYRPAPKARKIYNKMEL
TPKYHQQPKYRRCSVNSIHISPVNALSVYLTESYSICQPRKFQYSKSTNPKRVLTKPSEP
KFNNGYDNEDSDYILYVNDVLGSEEGKKYMVLDLLGSGTFGQVVKCQNLSNQSVCAVKVI
KSKPAYMNQSLTEVRLLEFLNTNSDGKSFIRLLDTFMHKEHLCLVFELLASNLYELIKQN
QFQGLNMKLVKIISKQLLEGLAQLKSFQMIHCDLKPENILLITGDKPTIKIIDFGSATFS
KNTIYSYIQSRFYRSPEVILGLSYGEAIDTWSLGCIVGELYLGLPLFPGTSEYNMLWKIQ
EMLGPPPRHMLLGRNSMNFYKKLPGKTPDDKPNYQIKTYEEYCQFLEQKKGSSAHEKENK
NYFKHKSLKDIIMNYRLPSKKMTNSMVEKEMRERELLVDFLTKVLNWNPIERLTPQEALK
HPWMNS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcatataataactataattataataggcataactcaataggtgggagttggcacttg
cctcccccttcataccaacaacaacagcaacaacagcaacagcaatctcagaatccacca
catcttcaacatcaatcactgcatcctactttaaatcaagatgtattaggaaatccaaat
gatcaatatcaacgtcctaatcagcatatgtcaggtttcagaaacccgtggtattcccaa
caacaacagcaacagcagcaggcgagtccaagttcttccttgttatcttcatcatcttta
tcacaatcaccaacaaaatcgcatcagataccgttgttgcaacagcaacaacagccgcca
ttgaataagcggttgtcattcgccaatcagttgccaacaacctatgaatatgagaatgat
aataacgttcctcctttcattcatccaccaacgcgtgctgacaacccattcaaccaatac
tttgcaaatcaagaagtgtctctaggaagcaatgatcgtaggatgtctgttgctatagat
ggaactcattataatccatttggtacatttggccaacaaaacaatgcctatccatctggt
cctgcaggtgtagctggccatcaatacttgaacaatccaaatttgggagccattcctgga
gctaacagaagatcttcattagccgttatgcccaatcattatcgtcaacaacagggtcca
caacaaccaatagatccaaattcaccagctgcagcatattacctaccacctgctcgtctt
ggtagatcagctctgatcattcaataccagcaatatcaacaggctttacaaaacctgaaa
gtcaacaaggcatatcgaccagcaccaaaagctcgcaagatctacaacaaaatggaatta
acaccgaaataccaccaacaacctaaatatcgtcgatgttcagttaattccatccacatt
tctcctgttaatgcattatcggtatatttgaccgaatcgtacagcatatgtcagccacgt
aagttccaatattcaaaatccacaaatccaaagagagtattgaccaaaccgctggagccg
aaatttaataatgggtatgataacgaagacagtgactatatcttgtatgttaatgatgtc
ttgggcagtgaagaaggaaagaagtatatggtgttggatttattaggatcaggaacattt
ggacaagttgttaaatgtcagaatctttctaaccaaagtgtttgcgcggtcaaagtgatc
aaatccaaacctgcatacatgaatcaatcgctcacagaagtcaggttattggagtttttg
aataccaatagtgatgggaaaagtttcatccgtttgttggatacatttatgcacaaggaa
catctttgtttagtgtttgaattgttggcatccaatttgtacgaattgatcaaacagaat
caattccaaggtctcaatatgaaacttgttaaaattatcagtaaacaacttttggaagga
ttggctcagctaaagagtttccagatgatacattgtgatttgaagccagagaatatattg
ttaataactggagataaacctacgattaaaatcattgactttgggtctgctacgttttca
aaaaataccatatacagttatattcaatctcgtttttatcgaagtccagaggttattctt
ggattgagttacggagaagctatagacacttggtcattaggatgtatagtaggtgaactt
tatcttggtcttccattattcccaggtacatctgagtacaacatgctatggaaaatacaa
gaaatgttgggtccaccacctcgtcatatgcttctcggacgaaactcgatgaatttttat
aagaaacttcctgggaaaacaccagacgataaaccaaattatcagatcaagacctacgag
gaatactgtcaatttttagaacaaaagaaaggatcaagtgctcatgaaaaggagaataag
aactatttcaaacacaaatctttgaaggatattatcatgaattatagattaccatcaaag
aaaatgacaaattccatggttgaaaaagagatgcgtgaacgagaattgttggttgatttt
cttacaaaagtactcaattggaatcctattgaaagattaactccacaagaagcattgaaa
catccttggatgaattcatag

DBGET integrated database retrieval system