KEGG   Candida tropicalis: CTRG_01717Help
Entry
CTRG_01717        CDS       T01115                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase TOR2
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ctp  Candida tropicalis
Pathway
ctp04136  Autophagy - other
ctp04138  Autophagy - yeast
ctp04139  Mitophagy - yeast
ctp04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    CTRG_01717
   04136 Autophagy - other eukaryotes
    CTRG_01717
   04139 Mitophagy - yeast
    CTRG_01717
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CTRG_01717
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CTRG_01717
Protein kinases [BR:ctp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   CTRG_01717
Membrane trafficking [BR:ctp04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    CTRG_01717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT HEAT_2 HEAT_EZ CLASP_N IFRD Cnd1 Cnd3 DUF1104 Hormone_3
Motif
Other DBs
NCBI-GeneID: 8301536
NCBI-ProteinID: XP_002547410
UniProt: C5M785
Position
Unknown
AA seq 2480 aa AA seqDB search
MSGSTTTQVQVVDGVALTEIFKELTSSSEEERAKYAEELHNYLSSIARDLSSEQFNRYNN
DINKTIFDLLHGEKTAEILGGIAALNALIEFDSGVGKENAGKTARFSNYLGSLILSNDLI
IMKQAISTLGKLATLGGNLTGDFVDFEAKRAIEWLQSDNKQHENRRHAAILIITALSDNA
PTLLYPLINQILENLWLPLRDHKLIVREDAAIALNKCMHIIYDRDVNARTFWIKRMIESA
SKLLNENDVTETSDSNSSYNIALSGQSSENIHGSLLIYRELLKYNKDPFIISRFEQMYEN
TYLYKHHKLPIIRQELTNIFPLLCRVNTELFVEKYLHRTLYYYLSQLKKYKGQHTEVANA
DKSAIFKSIGLIALEVGNQMATYLDAILDNIREGLSYTSNAGVQSILAKAVSNENPNIST
ANIASLTSGSKYTASRKETEPAIFDCIAKLSIAVGPALTKHLQRDILDMMFSNCSLSKHM
QDVLQILIINIPTLTNLINEKLLNLLSLVLSGKGFQPPGSPFGTIKVNPSLARDCRLIMI
SRDTGMSINNILMNQEQYDKLDSKILISALEMLAFFEFENYQLNEFVRYCTITYLEHNNA
KVRLTATVTSYEIFVKDPICQQVSVNALNTVNEVLGKLLSISITDPTPEIRLAGLNCLVK
AGNFDPQLSQADNVRLLFIALNDEVFAVRKVAIKILGRLSSINPAYIVPSLRKTLIQLLS
KLEYSTTSRKKEESAILLSLLISSSNELSRPYVKPIVDALLPKAKDLSSSVASSAIKCLG
ELSVVGGEDLKPFIPELMPLILETFQDQSSSYKRDAALKTLGQLASSSGYVIQPLLDYPQ
LLGMLVAILKSETSADIKRETVRLLGILGALDPYKHREVEQTSKSIPVEQNAPPVDVALL
MQGMSPSNEEYYPKVAITTLMKILKDPSLSIHHTKVIQAVMYIFQTLGLRCVAFLPQIIP
GIINVMHTCQQSMLKFYFQQLGDIILIVKQHIRPFLDDVFATIKEFFNINSQLNIQVTII
NVIQSISRALDGEFKMYLPEVLTLLLGVFEDDKSAKRSPSLHVLKSFVVFGSNIEEFVDI
VVPNIVKLFECGPVELRRAAIETVGRLSKNVMLNDMASRIIHPILRILSSGNIDLRESSI
NTLTYMLLQLGPEFTVFIPVIKKTLLQKNIHAPKFEQLVQKLVSGDPLPLHLDIYKDYDY
SRYDLADSDMPSKKLPVNQAALKAAWDASQRRTKEDWQEWIGRLSKELLLQSPSHAIRAC
AGLASDYYPLAKDLFNASFASCWSELYSQHKEELVEAFCIALSSPSNPPEIHQILLNLAE
FMEHDDKPLPIAISTLGQYAQRAHAFAKALHYKELEFYDQPTTPTIESLISINNQLQQSD
AAIGILKHAQLHHDLQLKETWYEKLQRWDDALKAYNEREKTEPNNMDITIGKMRCLHALG
EWEQLSELARSKWDNSSSDVKRSVAPLAAAAAWGLGQWDRMDSCIRVMKAESPDKAFFNA
ILSLHRNNFDDASIHILKARDLLVTEITALVSESYNRAYGVVVRVQMLAELEEIIKYKCL
PSGSEKRAVMRKTWNTRLLGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFANLCRKSGR
LNLAEKSLNLLLEEGSPENPSRAPPQVVYAQLKYMWAKGQRPEALRHLVDFTTRMSQDLG
LNPNDLITQPLPSEGPGIPKHVEDYTRLLARCFLKQGEWQIALNNNWRTETSEIILGAYL
LATHFDDKWYKAWHNWALANFEVISLYTSQNAPSSNGITSNKIEFLEEERNGNSDDIKVK
QFQQQQQSQAQQQQQANIIPIDAVQRHVIPSIRGFFHSIALSNSNSLQDMLRLLTLWFKF
GGITEAAQAMTEGFNMVKIDNWLEVVPQLISRIHQPNETVSRSLFGLLAELGKAHPQALV
YPLTVAITSESTSRKKAAQSIIEKMRVHSETLVDQAELVTPELIRVAVLWHEQWHDALED
ASRFFFGEHNTEKMFETLEPLHQLLQKGPETMREQAFTNAFGRELADAFEWVLNYRRTKD
ITNLNQAWDIYYNVFRRISKQLQSLISLELENVSPKLEQARDLELAVPGTYQAGKPIIRI
VRFDPTFSVISSKQRPRKFSCKGSDGKDYQYVLKGHEDIRQDNLVMQLFGLVNTLLVNDP
ECFKRHLDIQQYSAIPLSPKVGLLGWVPNSDTFHVLIKGYRESRSIMLNIEHRLLLQMAP
DYDMLTLLQKVEVFTSALDNCKGQDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYI
LGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIE
GSFRITCEHVMRVLRDNKESLMAILEAFAYDPLINWGFDFPTKALAEATGIRVAQVNTAD
LLRRGQIDEKEAARLQKQNELEIRNARAALVLKRITDKLTGNDIKRLRGLDVPTQVDKLI
QQATSVENLCQHYIGWCSFW
NT seq 7443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatctactactactcaggttcaagtggtagatggagttgccttaactgagatt
ttcaaagagttaacttcaagttctgaagaagaaagagctaaatatgctgaagaactacat
aattatttgtcgtccattgccagagatttatcatctgaacaattcaatagatataataat
gatataaataagacaatttttgatttattgcatggagagaaaactgcagagattttagga
ggtattgctgctttaaatgcattgattgaatttgattcaggtgtaggtaaagaaaatgct
ggaaaaactgcaagattttccaattatcttgggtctttaattttatctaatgatttgata
attatgaaacaagcaattagtacattgggtaaattagcaactttaggaggaaatttaact
ggagattttgttgattttgaagctaaaagagcaatagaatggttacaaagtgataataag
caacatgaaaatagaagacatgcagctatattgatcattactgccctttctgataatgct
cctactttattatatcctttaattaatcaaattttggagaatttgtggttacctttaaga
gatcataaacttattgttagagaggatgccgcgattgcccttaacaagtgtatgcatatc
atttatgatagagatgtgaatgctcgtactttttggattaaaagaatgattgaactggca
tcgaaattacttaacgagaatgacgtaacagaaacgtctgattcaaactcttcatacaat
attgcccttagtggtcaatctagtgaaaatatccatggttcattgttgatctacagagaa
ttactcaaatacaataaggatccttttatcatttcaagatttgaacaaatgtatgaaaat
acctatttgtacaagcaccataaattaccaattataagacaagaattaactaatatcttc
cccttgttgtgcagagtcaatacagaattgtttgtggaaaaatatttacatagaacatta
tattattatttatcacaactcaagaagtacaaaggtcaacatactgaagttgctaatgct
gataaaagtgccattttcaagagtattggtttgattgccttggaagttggtaatcaaatg
gcaacttatttagatgcaattttagataatattagagaagggttatcatatacatcaaat
gcgggagtgcaactgattctagccaaagctgtttcaaacgaaaatccaaatatcagtacg
gccaatatagcatctttgacatctggttcaaaatacactgccagtagaaaagaaaccgaa
ccagctatttttgactgtattgcaaaattatcaattgctgttggtcctgcattaacaaaa
catttacaaagagacatattagatatgatgttttccaattgttctttatctaaacatatg
caagatgttcttcaaattttgattatcaacattccgacattaacaaatttgattaatgaa
aaattattaaacttgttgagcttagtattatcaggtaaagggttccaaccaccaggatca
ccttttggcaccataaaggtaaacccatcactagcgagagattgcagattgattatgatt
tcaagagacacaggtatgagtatcaacaacatattgatgaaccaagaacaatatgataaa
ttggatagtaaaatattgattctggcgttggagatgttggctttttttgaatttgaaaac
tatcagttgaatgaatttgtaaggtattgtactatcacataccttgaacataataatgcc
aaggttcgtctcactgcaactgttacttcttatgaaatttttgttaaagatcccatttgt
caacaagtaagtgtcaatgcattaaatactgtcaatgaagttttggggaaattattatca
atatcaattactgatccaactccagaaattagattggctgggttgaattgtttagtcaaa
gctggcaattttgatcctcagttatcgcaagccgataatgttcgacttttgtttattgcc
ttgaatgatgaagtttttgctgtaagaaaagttgccattaaaatactcggaagattatca
tcaatcaacccagcatatattgttccctcactcagaaaaacacttatacaattgctttca
aaattggagtattctactaccagtcgtaagaaggaagaaagcgccatcttattatcttta
cttattagtagttccaatgagttatctcgtccttatgtcaaaccaatagttgatgcatta
ttacctaaagccaaggacttgagttcatccgttgcttctagtgctatcaagtgtttaggt
gagttatcagttgttggaggagaagatttaaaaccatttatccctgaattgatgcctttg
atcttggaaacattccaggatcaaagttcgtcttacaaaagagatgccgctttgaaaact
ttaggtcaattggcatcttcttctgggtatgtaattcagccattacttgattatccacaa
ttattaggtatgcttgtggcaattttgaaactggaaacctctgctgatatcaagagagaa
actgttagattgttgggtattttaggtgcacttgatccttataaacatagagaagttgag
caaacatcaaagagtataccggtagaacagaatgcaccaccagtggatgttgcattattg
atgcaaggaatgtcaccatcaaatgaagaatattatccaaaagttgccattactactttg
atgaaaatcttgaaagacccatcattaagtattcatcatacaaaagttattcaagctgtg
atgtacattttccagactttaggacttagatgcgttgcatttttaccacaaataattcct
ggaataatcaacgtcatgcatacgtgtcaacaatcaatgcttaaattttatttccaacag
ttgggtgatatcatcttaattgtcaagcaacacattcgtccatttttagatgatgttttt
gctactatcaaagaattttttaatatcaactcccaattgaatatccaagtcacaataatt
aatgttattcaatctatttcacgagcattagatggtgaatttaaaatgtacttaccagaa
gtgttgacattattgcttggagtatttgaagatgacaagtcagcaaaaagatcaccgtca
ttgcatgtgttaaagagttttgtcgttttcggcagcaacatagaggagtttgttgatata
gtcgtaccaaacattgtcaaattatttgaatgtggacccgttgaattgagaagagcagca
atcgagaccgttggtagattatcaaagaatgttatgttgaatgacatggcatcaagaatt
attcatccaattttaagaattcttagtctgggtaatatcgatcttcgagaatcttcaatt
aatactttgacatacatgttgcttcaattaggaccagaattcactgtattcattcctgtt
attaagaagacattgttacagaaaaacatccatgctcctaaatttgaacagttggtgcaa
aaattggtaagtggagatccattgccacttcatttggatatttacaaggattatgattac
agccgttatgatcttgctgattcggatatgccttcaaagaagcttcctgtaaaccaagcg
gcattaaaagcagcatgggatgccagccaacgtcgtaccaaagaagattggcaagagtgg
attggtagattaagtaaagaattattgttgcaaagtccatcacatgctataagagcttgt
gccgggttggcctctgattactatccattagctaaagatcttttcaatgctagttttgct
agttgctggagtgaattgtattctcaacataaagaagaactagttgaagctttctgtatt
gcactttcatcaccaagcaatccaccagagattcatcagattttattgaaccttgctgaa
tttatggaacatgatgacaaacctttgccaattgctatttctactttgggtcaatacgcc
caacgtgctcatgcttttgctaaagctttacattataaagaattggaattttatgaccaa
ccaactacacctactattgagtccttaattagtattaataaccaattacagcaatctgat
gcggctattggtattttgaaacatgctcaattacaccatgacttacaattgaaggaaacg
tggtatgaaaaattgcaacgatgggatgatgctttgaaagcttataatgaaagagaaaag
acagaaccaaataatatggatattactatcggtaagatgagatgtttgcatgcattaggt
gaatgggaacaattatccgagttggctcgtagcaagtgggataattcatcaagtgatgta
aagagaagtgttgcaccacttgcagctgctgccgcttggggattgggacaatgggatcga
atggattcttgtattagagtcatgaaggctgaatcacctgataaagcattcttcaatgca
attttaagtcttcaccgtaataatttcgatgatgcgtcaatacatattttgaaagcaaga
gatttattggttacagaaattactgctttagtaagtgaaagttataatagagcttatggt
gttgttgtgagagttcaaatgcttgcagaattggaagaaatcatcaaatacaaatgcttg
cctctgggttcagaaaaaagagctgttatgcgtaagacatggaatacaagattattgggt
tgtcaaagaaatgttgatatttggcaaagaatgttgaaagtcagagctttagtgatcaaa
ccaaagcaagacatggatatgtggatcaaatttgctaatttatgtagaaagtcaggaaga
ttgaatttggccgagaaatctttgaatttattattggaagaaggatcaccagaaaatcca
tccagggcaccaccacaagttgtttatgcacaattgaagtacatgtgggctaaaggtcaa
agaccagaagcattgcgtcatttagttgatttcactacgagaatgtcacaagatcttgga
ttgaatccaaatgatttgatcactcaaccattaccatcagaaggtccaggtattccaaaa
catgttgaagactataccagattgttggcaagatgtttcttgaaacaaggtgagtggcag
attgctttgaataataattggagaactgaaacttcagaaataattttgggagcctacttg
ttggccactcattttgatgacaagtggtataaagcttggcataattgggcattggccaac
tttgaagttatttccctttacacaagccaaaatgctccttctagtaatggaataacaagc
aacaagattgagtttttggaggaagagcgtaatggaaattcagatgatataaaagttaaa
caattccaacagcaacaacaactgcaagcacaacaacagcaacaagccaatatcattcca
atcgatgctgttcaacgacatgttatcccttcaattcgaggatttttccattctattgct
ttatctaactccaattcacttcaagatatgttgcgattgcttactttatggttcaaattt
gggggtattacagaggctgcccaggcaatgactgaagggttcaacatggtcaagatcgat
aattggttagaagtagttccacaattgatttcccgtattcaccaaccaaatgagaccgtt
agccgttcattgtttggtttattagcagaattaggtaaagcccacccgcaagctttggta
tatccattaacagttgctataacttctgaatctacgagccgtaaaaaggctgcacaatcg
attattgaaaaaatgagagtccattctgagacattagtcgaccaagctgaattggtaact
cctgaacttattcgagttgcagtattgtggcacgaacaatggcatgatgctttagaagat
gccagtagatttttctttggtgaacataatactgaaaagatgtttgaaactttagaacca
ttacaccaattgttgcaaaagggaccagaaaccatgagagaacaagcatttactaatgca
tttggaagagaattggccgatgcctttgaatgggttcttaattacagaagaacaaaggat
ataaccaacttgaatcaagcatgggatatttactataatgtatttagaagaatatccaaa
cagttacaactgttgattagtctcgagttggagaatgtttcacccaaattggaacaagca
cgtgatttggaattagctgttcctggtacatatcaagcaggtaagccgatcattagaatt
gttcgttttgatcctaccttttcagttatttcatctaaacaaagaccaagaaagttttct
tgtaaaggtagtgatggtaaggattaccagtatgtattgaaaggtcatgaagatatcaga
caagataatttagttatgcaattgtttggattggttaacactttgttggtaaatgatcct
gaatgtttcaagagacatttggatattcaacagtattcggctattccattatctccaaaa
gttggtttgttaggttgggttccaaacagtgatactttccatgtattgatcaaaggttat
agagagtcaagaagtattatgttgaatatcgaacatagattattattgcaaatggctccc
gattatgacatgttgacgttgttgcagaaggttgaagttttcaccagtgctttggataat
tgtaaaggtcaagatttgtataaggtattatggttaaagtcaaaatcatccgaagcttgg
ttagatagaagaactacatatactcgatctttagctgtcatgtcaatggttggttatatt
ttaggtttgggagatagacatccttcgaacttgatgttggaccgtattactggtaaagtc
attcatattgattttggtgattgttttgaagctgctattttgcgtgagaagtatccagag
aaggtcccatttagacttacaagaatgcttaattatgctatggaagttagtggaatcgaa
gggtcattcagaattacttgtgaacatgttatgagagttttgcgtgataataaagaatct
ttgatggctatattagaggcatttgcttatgatcctttaattaactggggttttgatttc
cctacaaaagcattagctgaagcaacaggtattagagttgcacaagttaatactgctgat
ttattgagaagaggacaaattgatgaaaaggaagctgctagattacagaaacaaaatgaa
ttagagattagaaatgctagagcagctttggttttgaaaagaatcactgataaattgact
ggtaatgatattaagcggttaagaggattggatgttccaacccaagtagataaattgatt
cagcaagcaactagcgtggaaaacttgtgtcaacactatatcggttggtgttccttctgg
taa

DBGET integrated database retrieval system