KEGG   Candida tropicalis: CTRG_01717Help
Entry
CTRG_01717        CDS       T01115                                 

Definition
phosphatidylinositol 3-kinase TOR2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ctp  Candida tropicalis
Brite
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CTRG_01717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2480 aa AA seqDB search
MSGSTTTQVQVVDGVALTEIFKELTSSSEEERAKYAEELHNYLSSIARDLSSEQFNRYNN
DINKTIFDLLHGEKTAEILGGIAALNALIEFDSGVGKENAGKTARFSNYLGSLILSNDLI
IMKQAISTLGKLATLGGNLTGDFVDFEAKRAIEWLQSDNKQHENRRHAAILIITALSDNA
PTLLYPLINQILENLWLPLRDHKLIVREDAAIALNKCMHIIYDRDVNARTFWIKRMIESA
SKLLNENDVTETSDSNSSYNIALSGQSSENIHGSLLIYRELLKYNKDPFIISRFEQMYEN
TYLYKHHKLPIIRQELTNIFPLLCRVNTELFVEKYLHRTLYYYLSQLKKYKGQHTEVANA
DKSAIFKSIGLIALEVGNQMATYLDAILDNIREGLSYTSNAGVQSILAKAVSNENPNIST
ANIASLTSGSKYTASRKETEPAIFDCIAKLSIAVGPALTKHLQRDILDMMFSNCSLSKHM
QDVLQILIINIPTLTNLINEKLLNLLSLVLSGKGFQPPGSPFGTIKVNPSLARDCRLIMI
SRDTGMSINNILMNQEQYDKLDSKILISALEMLAFFEFENYQLNEFVRYCTITYLEHNNA
KVRLTATVTSYEIFVKDPICQQVSVNALNTVNEVLGKLLSISITDPTPEIRLAGLNCLVK
AGNFDPQLSQADNVRLLFIALNDEVFAVRKVAIKILGRLSSINPAYIVPSLRKTLIQLLS
KLEYSTTSRKKEESAILLSLLISSSNELSRPYVKPIVDALLPKAKDLSSSVASSAIKCLG
ELSVVGGEDLKPFIPELMPLILETFQDQSSSYKRDAALKTLGQLASSSGYVIQPLLDYPQ
LLGMLVAILKSETSADIKRETVRLLGILGALDPYKHREVEQTSKSIPVEQNAPPVDVALL
MQGMSPSNEEYYPKVAITTLMKILKDPSLSIHHTKVIQAVMYIFQTLGLRCVAFLPQIIP
GIINVMHTCQQSMLKFYFQQLGDIILIVKQHIRPFLDDVFATIKEFFNINSQLNIQVTII
NVIQSISRALDGEFKMYLPEVLTLLLGVFEDDKSAKRSPSLHVLKSFVVFGSNIEEFVDI
VVPNIVKLFECGPVELRRAAIETVGRLSKNVMLNDMASRIIHPILRILSSGNIDLRESSI
NTLTYMLLQLGPEFTVFIPVIKKTLLQKNIHAPKFEQLVQKLVSGDPLPLHLDIYKDYDY
SRYDLADSDMPSKKLPVNQAALKAAWDASQRRTKEDWQEWIGRLSKELLLQSPSHAIRAC
AGLASDYYPLAKDLFNASFASCWSELYSQHKEELVEAFCIALSSPSNPPEIHQILLNLAE
FMEHDDKPLPIAISTLGQYAQRAHAFAKALHYKELEFYDQPTTPTIESLISINNQLQQSD
AAIGILKHAQLHHDLQLKETWYEKLQRWDDALKAYNEREKTEPNNMDITIGKMRCLHALG
EWEQLSELARSKWDNSSSDVKRSVAPLAAAAAWGLGQWDRMDSCIRVMKAESPDKAFFNA
ILSLHRNNFDDASIHILKARDLLVTEITALVSESYNRAYGVVVRVQMLAELEEIIKYKCL
PSGSEKRAVMRKTWNTRLLGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFANLCRKSGR
LNLAEKSLNLLLEEGSPENPSRAPPQVVYAQLKYMWAKGQRPEALRHLVDFTTRMSQDLG
LNPNDLITQPLPSEGPGIPKHVEDYTRLLARCFLKQGEWQIALNNNWRTETSEIILGAYL
LATHFDDKWYKAWHNWALANFEVISLYTSQNAPSSNGITSNKIEFLEEERNGNSDDIKVK
QFQQQQQSQAQQQQQANIIPIDAVQRHVIPSIRGFFHSIALSNSNSLQDMLRLLTLWFKF
GGITEAAQAMTEGFNMVKIDNWLEVVPQLISRIHQPNETVSRSLFGLLAELGKAHPQALV
YPLTVAITSESTSRKKAAQSIIEKMRVHSETLVDQAELVTPELIRVAVLWHEQWHDALED
ASRFFFGEHNTEKMFETLEPLHQLLQKGPETMREQAFTNAFGRELADAFEWVLNYRRTKD
ITNLNQAWDIYYNVFRRISKQLQSLISLELENVSPKLEQARDLELAVPGTYQAGKPIIRI
VRFDPTFSVISSKQRPRKFSCKGSDGKDYQYVLKGHEDIRQDNLVMQLFGLVNTLLVNDP
ECFKRHLDIQQYSAIPLSPKVGLLGWVPNSDTFHVLIKGYRESRSIMLNIEHRLLLQMAP
DYDMLTLLQKVEVFTSALDNCKGQDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYI
LGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIE
GSFRITCEHVMRVLRDNKESLMAILEAFAYDPLINWGFDFPTKALAEATGIRVAQVNTAD
LLRRGQIDEKEAARLQKQNELEIRNARAALVLKRITDKLTGNDIKRLRGLDVPTQVDKLI
QQATSVENLCQHYIGWCSFW
NT seq 7443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatctactactactcaggttcaagtggtagatggagttgccttaactgagatt
ttcaaagagttaacttcaagttctgaagaagaaagagctaaatatgctgaagaactacat
aattatttgtcgtccattgccagagatttatcatctgaacaattcaatagatataataat
gatataaataagacaatttttgatttattgcatggagagaaaactgcagagattttagga
ggtattgctgctttaaatgcattgattgaatttgattcaggtgtaggtaaagaaaatgct
ggaaaaactgcaagattttccaattatcttgggtctttaattttatctaatgatttgata
attatgaaacaagcaattagtacattgggtaaattagcaactttaggaggaaatttaact
ggagattttgttgattttgaagctaaaagagcaatagaatggttacaaagtgataataag
caacatgaaaatagaagacatgcagctatattgatcattactgccctttctgataatgct
cctactttattatatcctttaattaatcaaattttggagaatttgtggttacctttaaga
gatcataaacttattgttagagaggatgccgcgattgcccttaacaagtgtatgcatatc
atttatgatagagatgtgaatgctcgtactttttggattaaaagaatgattgaactggca
tcgaaattacttaacgagaatgacgtaacagaaacgtctgattcaaactcttcatacaat
attgcccttagtggtcaatctagtgaaaatatccatggttcattgttgatctacagagaa
ttactcaaatacaataaggatccttttatcatttcaagatttgaacaaatgtatgaaaat
acctatttgtacaagcaccataaattaccaattataagacaagaattaactaatatcttc
cccttgttgtgcagagtcaatacagaattgtttgtggaaaaatatttacatagaacatta
tattattatttatcacaactcaagaagtacaaaggtcaacatactgaagttgctaatgct
gataaaagtgccattttcaagagtattggtttgattgccttggaagttggtaatcaaatg
gcaacttatttagatgcaattttagataatattagagaagggttatcatatacatcaaat
gcgggagtgcaactgattctagccaaagctgtttcaaacgaaaatccaaatatcagtacg
gccaatatagcatctttgacatctggttcaaaatacactgccagtagaaaagaaaccgaa
ccagctatttttgactgtattgcaaaattatcaattgctgttggtcctgcattaacaaaa
catttacaaagagacatattagatatgatgttttccaattgttctttatctaaacatatg
caagatgttcttcaaattttgattatcaacattccgacattaacaaatttgattaatgaa
aaattattaaacttgttgagcttagtattatcaggtaaagggttccaaccaccaggatca
ccttttggcaccataaaggtaaacccatcactagcgagagattgcagattgattatgatt
tcaagagacacaggtatgagtatcaacaacatattgatgaaccaagaacaatatgataaa
ttggatagtaaaatattgattctggcgttggagatgttggctttttttgaatttgaaaac
tatcagttgaatgaatttgtaaggtattgtactatcacataccttgaacataataatgcc
aaggttcgtctcactgcaactgttacttcttatgaaatttttgttaaagatcccatttgt
caacaagtaagtgtcaatgcattaaatactgtcaatgaagttttggggaaattattatca
atatcaattactgatccaactccagaaattagattggctgggttgaattgtttagtcaaa
gctggcaattttgatcctcagttatcgcaagccgataatgttcgacttttgtttattgcc
ttgaatgatgaagtttttgctgtaagaaaagttgccattaaaatactcggaagattatca
tcaatcaacccagcatatattgttccctcactcagaaaaacacttatacaattgctttca
aaattggagtattctactaccagtcgtaagaaggaagaaagcgccatcttattatcttta
cttattagtagttccaatgagttatctcgtccttatgtcaaaccaatagttgatgcatta
ttacctaaagccaaggacttgagttcatccgttgcttctagtgctatcaagtgtttaggt
gagttatcagttgttggaggagaagatttaaaaccatttatccctgaattgatgcctttg
atcttggaaacattccaggatcaaagttcgtcttacaaaagagatgccgctttgaaaact
ttaggtcaattggcatcttcttctgggtatgtaattcagccattacttgattatccacaa
ttattaggtatgcttgtggcaattttgaaactggaaacctctgctgatatcaagagagaa
actgttagattgttgggtattttaggtgcacttgatccttataaacatagagaagttgag
caaacatcaaagagtataccggtagaacagaatgcaccaccagtggatgttgcattattg
atgcaaggaatgtcaccatcaaatgaagaatattatccaaaagttgccattactactttg
atgaaaatcttgaaagacccatcattaagtattcatcatacaaaagttattcaagctgtg
atgtacattttccagactttaggacttagatgcgttgcatttttaccacaaataattcct
ggaataatcaacgtcatgcatacgtgtcaacaatcaatgcttaaattttatttccaacag
ttgggtgatatcatcttaattgtcaagcaacacattcgtccatttttagatgatgttttt
gctactatcaaagaattttttaatatcaactcccaattgaatatccaagtcacaataatt
aatgttattcaatctatttcacgagcattagatggtgaatttaaaatgtacttaccagaa
gtgttgacattattgcttggagtatttgaagatgacaagtcagcaaaaagatcaccgtca
ttgcatgtgttaaagagttttgtcgttttcggcagcaacatagaggagtttgttgatata
gtcgtaccaaacattgtcaaattatttgaatgtggacccgttgaattgagaagagcagca
atcgagaccgttggtagattatcaaagaatgttatgttgaatgacatggcatcaagaatt
attcatccaattttaagaattcttagtctgggtaatatcgatcttcgagaatcttcaatt
aatactttgacatacatgttgcttcaattaggaccagaattcactgtattcattcctgtt
attaagaagacattgttacagaaaaacatccatgctcctaaatttgaacagttggtgcaa
aaattggtaagtggagatccattgccacttcatttggatatttacaaggattatgattac
agccgttatgatcttgctgattcggatatgccttcaaagaagcttcctgtaaaccaagcg
gcattaaaagcagcatgggatgccagccaacgtcgtaccaaagaagattggcaagagtgg
attggtagattaagtaaagaattattgttgcaaagtccatcacatgctataagagcttgt
gccgggttggcctctgattactatccattagctaaagatcttttcaatgctagttttgct
agttgctggagtgaattgtattctcaacataaagaagaactagttgaagctttctgtatt
gcactttcatcaccaagcaatccaccagagattcatcagattttattgaaccttgctgaa
tttatggaacatgatgacaaacctttgccaattgctatttctactttgggtcaatacgcc
caacgtgctcatgcttttgctaaagctttacattataaagaattggaattttatgaccaa
ccaactacacctactattgagtccttaattagtattaataaccaattacagcaatctgat
gcggctattggtattttgaaacatgctcaattacaccatgacttacaattgaaggaaacg
tggtatgaaaaattgcaacgatgggatgatgctttgaaagcttataatgaaagagaaaag
acagaaccaaataatatggatattactatcggtaagatgagatgtttgcatgcattaggt
gaatgggaacaattatccgagttggctcgtagcaagtgggataattcatcaagtgatgta
aagagaagtgttgcaccacttgcagctgctgccgcttggggattgggacaatgggatcga
atggattcttgtattagagtcatgaaggctgaatcacctgataaagcattcttcaatgca
attttaagtcttcaccgtaataatttcgatgatgcgtcaatacatattttgaaagcaaga
gatttattggttacagaaattactgctttagtaagtgaaagttataatagagcttatggt
gttgttgtgagagttcaaatgcttgcagaattggaagaaatcatcaaatacaaatgcttg
cctctgggttcagaaaaaagagctgttatgcgtaagacatggaatacaagattattgggt
tgtcaaagaaatgttgatatttggcaaagaatgttgaaagtcagagctttagtgatcaaa
ccaaagcaagacatggatatgtggatcaaatttgctaatttatgtagaaagtcaggaaga
ttgaatttggccgagaaatctttgaatttattattggaagaaggatcaccagaaaatcca
tccagggcaccaccacaagttgtttatgcacaattgaagtacatgtgggctaaaggtcaa
agaccagaagcattgcgtcatttagttgatttcactacgagaatgtcacaagatcttgga
ttgaatccaaatgatttgatcactcaaccattaccatcagaaggtccaggtattccaaaa
catgttgaagactataccagattgttggcaagatgtttcttgaaacaaggtgagtggcag
attgctttgaataataattggagaactgaaacttcagaaataattttgggagcctacttg
ttggccactcattttgatgacaagtggtataaagcttggcataattgggcattggccaac
tttgaagttatttccctttacacaagccaaaatgctccttctagtaatggaataacaagc
aacaagattgagtttttggaggaagagcgtaatggaaattcagatgatataaaagttaaa
caattccaacagcaacaacaactgcaagcacaacaacagcaacaagccaatatcattcca
atcgatgctgttcaacgacatgttatcccttcaattcgaggatttttccattctattgct
ttatctaactccaattcacttcaagatatgttgcgattgcttactttatggttcaaattt
gggggtattacagaggctgcccaggcaatgactgaagggttcaacatggtcaagatcgat
aattggttagaagtagttccacaattgatttcccgtattcaccaaccaaatgagaccgtt
agccgttcattgtttggtttattagcagaattaggtaaagcccacccgcaagctttggta
tatccattaacagttgctataacttctgaatctacgagccgtaaaaaggctgcacaatcg
attattgaaaaaatgagagtccattctgagacattagtcgaccaagctgaattggtaact
cctgaacttattcgagttgcagtattgtggcacgaacaatggcatgatgctttagaagat
gccagtagatttttctttggtgaacataatactgaaaagatgtttgaaactttagaacca
ttacaccaattgttgcaaaagggaccagaaaccatgagagaacaagcatttactaatgca
tttggaagagaattggccgatgcctttgaatgggttcttaattacagaagaacaaaggat
ataaccaacttgaatcaagcatgggatatttactataatgtatttagaagaatatccaaa
cagttacaactgttgattagtctcgagttggagaatgtttcacccaaattggaacaagca
cgtgatttggaattagctgttcctggtacatatcaagcaggtaagccgatcattagaatt
gttcgttttgatcctaccttttcagttatttcatctaaacaaagaccaagaaagttttct
tgtaaaggtagtgatggtaaggattaccagtatgtattgaaaggtcatgaagatatcaga
caagataatttagttatgcaattgtttggattggttaacactttgttggtaaatgatcct
gaatgtttcaagagacatttggatattcaacagtattcggctattccattatctccaaaa
gttggtttgttaggttgggttccaaacagtgatactttccatgtattgatcaaaggttat
agagagtcaagaagtattatgttgaatatcgaacatagattattattgcaaatggctccc
gattatgacatgttgacgttgttgcagaaggttgaagttttcaccagtgctttggataat
tgtaaaggtcaagatttgtataaggtattatggttaaagtcaaaatcatccgaagcttgg
ttagatagaagaactacatatactcgatctttagctgtcatgtcaatggttggttatatt
ttaggtttgggagatagacatccttcgaacttgatgttggaccgtattactggtaaagtc
attcatattgattttggtgattgttttgaagctgctattttgcgtgagaagtatccagag
aaggtcccatttagacttacaagaatgcttaattatgctatggaagttagtggaatcgaa
gggtcattcagaattacttgtgaacatgttatgagagttttgcgtgataataaagaatct
ttgatggctatattagaggcatttgcttatgatcctttaattaactggggttttgatttc
cctacaaaagcattagctgaagcaacaggtattagagttgcacaagttaatactgctgat
ttattgagaagaggacaaattgatgaaaaggaagctgctagattacagaaacaaaatgaa
ttagagattagaaatgctagagcagctttggttttgaaaagaatcactgataaattgact
ggtaatgatattaagcggttaagaggattggatgttccaacccaagtagataaattgatt
cagcaagcaactagcgtggaaaacttgtgtcaacactatatcggttggtgttccttctgg
taa

DBGET integrated database retrieval system