KEGG   Candida tropicalis: CTRG_01746Help
Entry
CTRG_01746        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ctp  Candida tropicalis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CTRG_01746
   03420 Nucleotide excision repair
    CTRG_01746
   03430 Mismatch repair
    CTRG_01746
   03440 Homologous recombination
    CTRG_01746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 266 aa AA seqDB search
MSDFGFDAYSGGGFGNISQGGFSADHQGSSQSQKSNQVRQSLTPVTIKQINDASQHVPDA
EFKVNNVELNMISFVGVVRKVDNNNATIVITIEDGTGSIEVRVWISEQITTAEQETQKYE
ALLNRYVFVGGSLKQFNNRKSVQNSSIFPITDSNQILYHHLSAIENHLKAQGIQKPSSSG
GSLFVDGNSNTNSGVAGAQGNQGGSLTDRVLAVLKENSTTMQEGVPVDYISQKLNISREE
ALEHVNKLVEGGKAYAGYDDNTYICI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttcgggttcgatgcatatagtggtggtggatttggaaatatttcacaaggt
ggattttcagctgatcatcaaggatcttcacaatctcaaaaatccaatcaagtaagacaa
agtttaactcctgttacaattaaacaaattaatgatgcttcacaacatgtaccagatgca
gaatttaaagttaataatgttgaattaaatatgatatcgtttgttggagtagtaagaaaa
gttgataataataatgctactattgttattacaattgaagatggaactggatcaattgaa
gttcgtgtttggatatctgaacaaattacaactgcagaacaagaaactcaaaaatatgaa
gctttacttaatagatatgtttttgttggtggatctttaaaacaatttaataatcgtaaa
agtgttcaaaattcatcaattttcccaattactgatagtaatcaaattttatatcatcat
ctaagtgcaattgaaaatcatttgaaagctcaaggtattcaaaaaccaagtagttctggt
ggatctttatttgttgatggtaattctaacaccaactcaggagttgctggtgctcaagga
aatcaaggtggttctcttactgatcgtgttttggctgttttgaaagaaaatagtaccacc
atgcaagaaggtgttcctgttgattatataagtcagaaattaaacatttcaagagaagaa
gctcttgaacatgtcaataaattggttgaaggtggtaaagcatatgctggttatgatgat
aacacttacatttgtatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system