KEGG   Candida tropicalis: CTRG_01869Help
Entry
CTRG_01869        CDS       T01115                                 

Definition
similar to C-14 sterol reductase
Orthology
K00222  
delta14-sterol reductase [EC:1.3.1.70]
Organism
ctp  Candida tropicalis
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CTRG_01869
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CTRG_01869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 275 aa AA seqDB search
MAATKLNPFTTHKEFNGTTGAIAISFGLPVLIYFFQLICNNSYSIQGINLDLNKVIEQLP
SSTDDLMNLLFDKTCWTVYLLWFFILVAFDFILPGKSLNGVTLRDGTSLNYKINGLSMSL
LLVTLLSARLIQSDNYYLPELDFIYSNQAQLIMVCFLFSFILAVICYIMSFIPLVKPNGL
NTRDRILSINGNTYNPFYDWFIGRELNPRIGSWDIKLFCELRPGMLLWLLINLSCAHHQY
HKLGYVTDSIIVVNLLQSFYIFDGVLNEERVFNND
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaacaaagttaaatccttttacaactcataaagagttcaatggtactactggt
gcaattgccatttcttttggtttacctgtattgatttatttttttcaattaatatgtaat
aattcatattcaatccaagggattaatcttgatttaaacaaagttattgaacaattacct
tcatctaccgatgatttaatgaacttattatttgataaaacttgttggacagtctatctt
ttatggtttttcatcttggttgcatttgatttcatcttacctggtaaatcattaaatggt
gttactcttagagatggtacttcattaaattacaaaattaatggattaagtatgagttta
ttattggttactttattatctgctaggttaattcaactggataattattatttaccagaa
ttagatttcatttattcaaatcaagcacaattgatcatggtttgtttcttgttttcattt
attttggctgttatatgctatatcatgtcttttattccattggttaaaccaaatggtttg
aatacaagagacagaattttgagtattaatggaaatacttataatccattttacgactgg
ttcattggtagagaattaaacccaagaattggttcatgggatattaaattattttgtgaa
ttacgtcccggtatgttgttatggttattgatcaatcttagttgtgctcatcatcaatat
cataaactaggctatgttactgattcaatcattgtggttaatttattacaatcattttat
attttcgatggtgttttgaatgaagaaagggtgtttaacaatgattga

DBGET integrated database retrieval system