KEGG   Candida tropicalis: CTRG_01869Help
Entry
CTRG_01869        CDS       T01115                                 

Definition
(RefSeq) similar to C-14 sterol reductase
Organism
ctp  Candida tropicalis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 275 aa AA seqDB search
MAATKLNPFTTHKEFNGTTGAIAISFGLPVLIYFFQLICNNSYSIQGINLDLNKVIEQLP
SSTDDLMNLLFDKTCWTVYLLWFFILVAFDFILPGKSLNGVTLRDGTSLNYKINGLSMSL
LLVTLLSARLIQSDNYYLPELDFIYSNQAQLIMVCFLFSFILAVICYIMSFIPLVKPNGL
NTRDRILSINGNTYNPFYDWFIGRELNPRIGSWDIKLFCELRPGMLLWLLINLSCAHHQY
HKLGYVTDSIIVVNLLQSFYIFDGVLNEERVFNND
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaacaaagttaaatccttttacaactcataaagagttcaatggtactactggt
gcaattgccatttcttttggtttacctgtattgatttatttttttcaattaatatgtaat
aattcatattcaatccaagggattaatcttgatttaaacaaagttattgaacaattacct
tcatctaccgatgatttaatgaacttattatttgataaaacttgttggacagtctatctt
ttatggtttttcatcttggttgcatttgatttcatcttacctggtaaatcattaaatggt
gttactcttagagatggtacttcattaaattacaaaattaatggattaagtatgagttta
ttattggttactttattatctgctaggttaattcaactggataattattatttaccagaa
ttagatttcatttattcaaatcaagcacaattgatcatggtttgtttcttgttttcattt
attttggctgttatatgctatatcatgtcttttattccattggttaaaccaaatggtttg
aatacaagagacagaattttgagtattaatggaaatacttataatccattttacgactgg
ttcattggtagagaattaaacccaagaattggttcatgggatattaaattattttgtgaa
ttacgtcccggtatgttgttatggttattgatcaatcttagttgtgctcatcatcaatat
cataaactaggctatgttactgattcaatcattgtggttaatttattacaatcattttat
attttcgatggtgttttgaatgaagaaagggtgtttaacaatgattga

DBGET integrated database retrieval system