KEGG   Candida tropicalis: CTRG_01919Help
Entry
CTRG_01919        CDS       T01115                                 

Definition
asparagine synthetase 2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ctp  Candida tropicalis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTRG_01919
Enzymes [BR:ctp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CTRG_01919
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C44
   CTRG_01919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 575 aa AA seqDB search
MCGIFAAYRQPQVDEFKGKALQYSKLIRHRGPDWSGNVVQNSTILCHERLAIVGLDSGAQ
PIVSPDGNFTLAVNGEIYNHIQLREQFPDYKFKSLSDCEPIIPLFEKYDTDAPKYLDGMF
AWVLYDKKNDRIVAARDPIGITTLYMGKSSKTPNTRYFASELKCLTEECDEIIAFPPGHV
YDSNTDKLTRYFEPTWWDSSKIPQTPVDYKQVRETLELAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETKKAATTISPTGIDANKELSGVDDKGSLHSTGAYNQLHSFAIGLPGAPDL
LAAEKVAHFIGTIHHSHTFTLEEGHDALDDVIYHLETYDVTTIRASTPMYLLSRKIKAQG
VKMVLSGEGSDEIFGGYLYFANAPDAKEFHQECVSRVKNLYYADCLRANKSTMAWGLEAR
VPFLDKQFLEVCMNINPEDKMIKPGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQKEQF
SDGVGYSWIDSLKDTAEKVVSDEDFANPPAHWSPFVPSTKEAYWYRQKFDKVFGVKGAEV
ASQTVSLWVPRVDWPGNVSQDASGRYQSTHVASVV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatttttgctgcttatagacaaccacaagttgatgaatttaaaggcaaggcc
ttacaatactccaaattaattagacatagaggtccagattggtcaggtaatgttgttcaa
aacagtactattttatgtcatgaaagattagctattgttggtttagattctggtgctcaa
ccaattgtttccccagatggtaactttactttggctgttaatggtgaaatttataaccat
attcaattaagagaacaatttcctgattataaatttaaatctttaagtgattgtgaacca
atcattccattattcgaaaaatatgatactgatgctccaaaatatttagatggtatgttt
gcttgggttttatatgataaaaaaaatgatagaattgttgccgctagagatccaatcggt
attactactttatacatgggtaaatcttcaaaaactccaaacactagatattttgctagt
gaattgaaatgtttaactgaagaatgtgatgaaattattgctttccctccaggtcatgtt
tatgattcaaacactgataaattaacaagatatttcgaaccaacttggtgggattcttct
aaaattcctcaaactccagttgattacaaacaagttagagaaactttagaattggctgtt
agaaagagattgatggctgaagttccatatggtgttttattatctggtggtttggattct
tctttaattgcttctattgctgctagagaaactaaaaaagctgccactaccatcagtcca
accggtattgatgccaacaaagaattatctggtgttgatgataagggttctttacattct
actggtgcttataaccaattacattcatttgccattggtttaccaggtgctccagattta
ttagctgctgaaaaagttgctcatttcattggtactattcatcattctcatacttttact
ttagaagaaggtcatgatgccttagatgatgtcatttatcatttggaaacttatgatgtt
actaccattagagcttctactccaatgtatttattatctagaaaaattaaagctcaaggt
gttaaaatggttctttctggtgaaggttctgatgaaatctttggtggttatttatatttt
gctaatgctccagatgctaaagaattccatcaagaatgtgtttcaagagttaaaaacttg
tattatgctgattgtcttagagctaacaaatctaccatggcttggggtttggaagcaaga
gttccatttttggataaacaatttttggaagtttgtatgaacattaaccctgaagataaa
atgattaaaccaggtagaattgaaaaatacattttaagaaaagcttttgatacttctgat
gaaccagatgttaaaccatatttaccagaagaaattctttggagacaaaaagaacaattt
tcagatggtgttggttattcttggattgatagtttaaaagatactgctgaaaaagttgtt
agtgatgaagattttgctaatcctccagctcattggagtccatttgttccaagtactaaa
gaagcttattggtatagacaaaaattcgataaagtctttggtgttaaaggtgctgaagtt
gctagtcaaactgtttccctttgggttccaagagttgattggccaggtaatgtttctcaa
gatgcttctggtcgttaccaatctactcatgttgcctctgttgtttaa

DBGET integrated database retrieval system