KEGG   Candida tropicalis: CTRG_02020Help
Entry
CTRG_02020        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ctp  Candida tropicalis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctp03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 847 aa AA seqDB search
MNNRPNAPFKAPRLMKNTGQSVVRPVLSVNKPTIKRSYSRPTVGSNAATTNPPIKKSRPS
TPNGSNIEKYIIQWRKKTTKKNKTWDGDGHATIHHLENGGCEIFAKNSDNKSLGKRSFNV
SPNFEEVISLGTFEIELDEKVSGSQESQEEAPRKPVLKRVSPVPTTTENATNQFKKVAPP
TYVERPTSRKAMYDDNPSAISLPPPPGTSNFVKVNIDPLLATKLRHHQIEGVTFMYECLM
GYRDFQGHGCLLADEMGLGKTLMTITTIWTLLKQNPFPEQKKPVINKVLVVCPATLISNW
RQEFKKWLGANKLNVLTLNNAMSDEKRDILNFGKLNVYQVLVVNYEKITIHYEELSTIKF
DLLVCDEGHRLKNSANKVLNHLIKLNIPKKIVLTGTPIQNELIEFHTLISFLNPGVLPEL
KTFQRNYVNPISRARDVNCFDPEVKRRGEEISQQLIGLTSQFILRRTQSILSKYLTTKTD
ILLFVPPSDLQVKLFKYITNLKKFNQINSGSDSFTLINLFKKICNSPSLLIDDAFFKRIV
EEKFHLTLSSGKINVLIPLLLEIVAQKEKIVLISNYTQTLDLLEKVLSKINLTFSRLDGS
TATNIRSKIVKQFNSNPNIHVFLLSSKSGGMGINLVGASRLILFDNDWNPATDLQSMSRI
HRDGQTKPCFIYRIFTTGCIDEKIFQRQLVKNRLSSKFLDNDSSSKSDIFDESDLKNIFE
VDTNTISNTHDLLECSCDGDGSTLNEQLSQSQEKSGNEQEEPPFATQSWVSALELQKKMV
DNGDILKKSAVKSALSDYQHYNPNVNKNLTFDTVLDRLANNPSFRDKKLPITFIMSRISN
QDQPNTE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgacctaatgcaccatttaaagcgccgaggttgatgaaaaatactggccaa
tcagtagtcagaccagtattatcagtgaataaaccaactattaaaagatcatattctcga
ccaactgttggatcaaatgctgcaaccacaaatcctcctataaagaaatccagaccatca
acacccaatggatccaatatagaaaaatatatcattcaatggagaaagaaaactacaaaa
aagaataaaacttgggatggagatggccatgctactattcatcaccttgaaaatggtgga
tgtgagatatttgcaaagaactcagacaataaatccctaggaaaaagatcattcaatgtt
ctgccaaatttcgaagaagtgataagtttaggaacttttgaaattgaattagatgaaaaa
gtatctgggtctcaagaatcacaggaagaagcgcctcgaaagccagttttaaaacgcgtg
tctccagtaccgactactactgagaatgcaaccaatcagttcaaaaaagttgcacctcct
acttatgttgaaagacctacttccagaaaagcaatgtatgatgataatcctagtgcaatt
tcattaccaccacctcctggtacgtcaaattttgtcaaggtaaatatagacccacttttg
gcaacaaaattgcgacaccatcaaattgaaggagtgacgtttatgtatgaatgtcttatg
ggatatcgtgatttccagggacatggatgcttgttagctgatgaaatggggttagggaaa
actctaatgacaattactactatttggactttacttaaacaaaacccatttcctgaacag
aagaaacctgttatcaataaagttttagttgtatgtcctgcaactcttatttcaaactgg
agacaagagttcaagaaatggttaggtgcaaacaaactaaatgtcctcacattaaacaat
gccatgtcagatgaaaagagagacattttaaatttcggaaaattgaatgtgtatcaggtt
ttggttgtcaattatgaaaaaataactattcattatgaggaattatccactataaagttt
gatttgttggtttgtgatgaaggtcatcggttgaagaatagtgccaataaagtcttaaac
catttaattaaattgaatatcccaaaaaagattgtgttaactggtactcctattcaaaat
gaattgattgagtttcataccttgatatcatttcttaacccgggagttctccctgaatta
aagacttttcaaaggaattacgtgaatccgatatctcgagctcgagatgtaaattgtttt
gatccagaagtgaaacgaagaggggaagaaatctcacaacagttgattggattaaccctg
cagtttatattacgaagaacgcaatctatattgtcaaaatatttaactaccaaaactgat
atcctattatttgttcctcccagtgatttgcaagtcaagttattcaaatatatcactaat
ttgaagaagttcaatcagatcaatagtggttcagattcatttactttaattaatttgttc
aagaaaatttgcaactcgccttctttgttgatagatgacgcatttttcaaaaggattgtt
gaagaaaagtttcatctaactttatcatccggcaaaattaacgttttgatacctttatta
ttagaaattgttgcacaaaaggaaaaaattgttttaatttcaaattatacccaaactttg
gatcttttggagaaggtgttgtcaaagatcaatttaacattttctagattggatggctct
actgctacaaatatcagaagtaaaatcgtgaagcagttcaacagcaacccaaatattcat
gtatttttattgtcatcaaaatcaggtggtatgggaataaatctagtaggtgcatcaaga
ttgattttatttgacaacgattggaatccagcaactgacttacaatccatgtcaagaatc
catagagatggtcaaacgaaaccttgttttatttatagaattttcaccaccggatgtatt
gatgaaaaaatattccaacgtcaattagttaaaaacaggttaagttcaaaatttttagat
aatgattcatcaagtaaatcggatatatttgatgaaagtgatctaaaaaatatatttgag
gttgatacaaacactatttcaaatacacatgatttattagaatgttcatgtgatggtgat
ggatcaacactaaatgaacaattatcccaatctcaagaaaaatcaggtaatgaacaagag
gaaccaccatttgctactcagtcttgggtgtctgcattggagcttcaaaagaaaatggtt
gataatggtgatatcttgaagaaatcagcagttaaatcggcattaagtgattatcaacat
tataatcctaatgtaaacaaaaacttgacttttgataccgttctagatcgtcttgctaat
aatcctagttttcgtgataaaaaattacccattacttttattatgctgagaataagtaat
caagatcaaccaaatacagaataa

DBGET integrated database retrieval system