KEGG   Candida tropicalis: CTRG_02032Help
Entry
CTRG_02032        CDS       T01115                                 

Definition
acetyl-coenzyme A synthetase 1
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ctp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ctp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ctp00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 674 aa AA seqDB search
MPESTQQSHISLDHEKMQQPPAGFTERSTSKPNLPDFDTYKKLYQQSVENPNEFFTEQAK
KNLDWFKPFDLARFPVDPKDDFKNGDLPAWFINGQLNASYNAIDRWAIKNPDKPAIIYEG
DEPDQGRIISYGELLKEVSKLAQTLTKLGVKKGDSVAVYLPMIPEAIVTLLAIVRIGAVH
SVVFAGFSSASLRDRILDADSRIVITADESKRGGKTIETKKIVDDALKECPKVRNVIVFK
RTGNSHVPFSPGRDLWWHEELAKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAG
YLLGAVLTTKYTFDVHEDDVLFTAGDVGWITGHTYCVYGPLLCGATTVVFEGTPAYPNFS
RYWEIVDKYKVNQFYVAPTALRLLKRAGTKYVEKYDLSSIRVLGSVGEPIAAEVWHWYND
NIGRGKAHIVDTYWQTESGSHLLTPLAGVTPTKPGSASLPFFGVVPKILDPTTGQELEGN
DVEGVLAIKSAWPSITRGIYNDYNRFIETYLAPYHDHYFSGDGAARDNDGFYWILGRVDD
VVNVSGHRLSTAEIEAALIEHPLVAESAVVGYADDLTGQAVAAYVSLKKDKVNDDLEAVK
KELILTVRKEIGPFAAPKLILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLSNPG
VVQQIIEVVHASKK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatctactcaacaatctcatatttctttggatcatgaaaagatgcagcaacct
ccagctggtttcactgaacgttccacttccaaaccaaacttaccagatttcgacacttac
aagaaattgtaccaacaatctgtagaaaatccaaatgaatttttcaccgaacaagcaaag
aagaatttagactggttcaaaccatttgatttggctagattccctgtcgatccaaaagat
gatttcaagaatggtgatttgccagcttggtttatcaatggtcaattgaatgcttcatac
aatgctattgatagatgggctatcaagaacccagataagccagctattatttacgaaggt
gatgaaccagatcaaggtagaatcatttcttatggtgaattattgaaagaagtcagtaaa
ttggctcaaactttgactaaattgggtgttaaaaaaggtgattctgtcgctgtttactta
ccaatgattcctgaagctattgtcactttattggccattgtcagaattggtgctgtccat
tctgttgtctttgctggtttctcttctgcctctttaagagacagaattttagatgctgac
tctagaattgtcatcactgctgatgaatccaagagaggtggtaaaactatcgaaaccaag
aagattgttgatgatgctttgaaggaatgtccaaaagtcagaaatgtcattgttttcaaa
agaactggtaactcacatgttccattttctcctggtagagatttatggtggcacgaagaa
ttggccaaatacggtccatacttcccaccagtcccagttaactctgaagatccattgttc
ttgttgtatacttctggttctactggtaagccaaagggtgttcaacataatactgctggt
tacttgttgggtgccgttttaaccaccaaatacacctttgatgtccatgaagatgatgtc
ttgttcactgctggtgatgttggttggattactggtcacacttattgtgtttacggtcca
ttgttgtgtggtgccactactgttgtctttgaaggtactccagcttatccaaacttctcc
agatactgggaaattgttgacaaatataaggttaaccaattctatgttgcaccaactgct
ttaagattattgaagagagctggtaccaagtatgttgaaaaatacgacttgtcctccatt
agagtcttgggttctgttggtgaaccaattgctgctgaagtttggcactggtataatgac
aatattggtagaggtaaagctcatattgtcgatacttattggcaaactgaatctggttct
catttgttgactccattggctggtgtcactccaaccaagccaggttctgcttccttgcca
ttctttggtgttgttccaaagatcttagatccaactactggtcaagaattagaaggtaac
gatgttgaaggtgtccttgctattaaatctgcttggccatctattactagaggtatttac
aatgattacaatagatttattgaaacttatttggctccataccacgaccactatttctca
ggtgatggtgctgctagagataacgatggtttctactggatcttgggtagagttgatgat
gttgtcaatgtttctggacacagattatcaactgccgaaatcgaagctgctttgattgaa
catccattggttgcagaatctgctgttgtcggatatgccgatgacttgactggtcaagcc
gttgctgcttatgtttccttgaagaaagataaggttaatgatgatttggaagctgtcaag
aaggaattgattttaactgtcagaaaagaaattggtccatttgctgctcctaaattgatt
ttgttggttgatgacttgccaaagaccagatctggtaagattatgagaagaatcttgaga
aaagttttggctggtgaagaagatcaattgggtgatatttccacattatctaatccaggt
gttgttcaacaaatcattgaagttgtccatgcttcaaagaaataa

DBGET integrated database retrieval system