KEGG   Candida tropicalis: CTRG_02085Help
Entry
CTRG_02085        CDS       T01115                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ctp  Candida tropicalis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CTRG_02085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRKSGLAEGYSYTDANK
KKGVEWTEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLKKATS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttctgaaaagaaaggtgccactttattcaaaactaga
tgtttacaatgtcacaccgttgaaaaaggtggtccacacaaggttggtccaaatttacat
ggtgttttcggtagaaaatccggtttagctgaaggttactcttacactgatgctaacaaa
aagaagggtgttgaatggaccgaacaaaccatgagtgattacttggaaaacccaaagaaa
tatattccaggtaccaagatggccttcggtggtttgaagaaaccaaaggacagaaacgat
ttggttacttacttgaagaaggctacttcttaa

DBGET integrated database retrieval system