KEGG   Candida tropicalis: CTRG_02092Help
Entry
CTRG_02092        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CTRG_02092
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_02092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1359 aa AA seqDB search
MISNNNNNPSDVSVNIDELPDSKKQLTENQPDPALKSNIATMTQQQQQQQQQQSMEIDSV
TDEFIDNNPNGLDTREIDDISVDKDYGLNQPEPIPIEDDNQGQVVDSELVEEEEEEEEDD
DDDDDDDDDEIEGNVQIVEDRGISKNTKSAYPLANEFEDLAAKLMKPIDDYPIKDEAHYV
WEIKDWHSILKEDKVRSPRFKCGGFEWNILLFPRGNTHNNQISIYMEPHPPVDENDKPID
EDWYVCAQFGLDIWNPQHPDAHSPSQSHHRFNKNETDWGFGSLIELRQLSMVRTPRNQSS
SHALLENNQLNITGYVRVIDDSSTGVLWHNFVEYDSKKNAGFVGLNNQGATCYLNSLLQS
YFTTKLFRKLVYKIPTDSKSSGVALSLQRIFYLLTKSNDPVGTLELTRSFGWDSSDAFTQ
HDVQELNRILMDKLETAMKGSDIEGALNDIFVGKMKSYIKCVNVPYESSRVEDFWDIQLN
VKGFKNLEQSFQNYIEIEMLEGENKYQAGDEYGYQDAKKGVVFESFPPVLHLQLKRFEYD
FMVDDLVKIDDFYEFPDKIDLKPYLDEDLPDDVKNQNWNYKLHGVLVHQGSISNGHYYAM
IKPNSRDNTWLRFDDDRVWKVTKKEVFQQNFGASDISQAQLNKMTRAEQQEHLMRRMTSA
YMLVYYRESELDKILPTDDSLVESAIPEHIPKQIEFEIAERERLEKQRQEELYYTTAKLV
TTATINAHVGFDLALDRTVHKFYDEELEGTACDPVVLKVKKDSKMSELIESVGKSLGYDD
VNLFRLVTICHRNNHSNRLDACVEKKLESYTISDFYFKIFNRKYDEMVFYVEELNKDIRN
IIQLVDTEYIEPKDFTFEQVFSKIESTGNKIGEGMRFENTEAYANHITIIIKYFDPISQE
IRSLSHIVVAKSDQIKTIIDPIKKLLGFKDDVELEMFEELSPSKVDKIDPELTFNKQELS
HGDILTVQVVNPGELNKDGQFKDLREYYKFLLTRLHVNVRPFKADIDEEDSDFVANDEDD
MDQDGVHSEDNEVTNEEIQRAKNLSRSFDFWISTSYSYHDLAKAIAVKLNVDPAYLRIFA
LSSSGERFPLKSNSYVSQYVARSVPVSAIFEFEYEILNIPLVEYENMKAVKIHWLVTLLQ
SQVFDVLVPKLGTIGDVVTKLLHKVNVEKKDLPHLFVWSGSHHNYQDMYKADTPLNQIPD
GVDLYCGLFPTEVESLCHFDMYKRFFPQEIKVDEIDAVDREEFLAVKAAGDQLNFLPAFH
FYKAGDSRHGIPFVFVVLPNEPLSETKERLRKKLGLGKQAFDKIRLALADINFKGSYLEG
KDNLILFDEIANKRLSLGLDHPDRTPRRQSQFDKGISIK
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaaataataacaacaatccttctgatgtatctgtcaatattgatgaattaccg
gattctaaaaagcaattgacggagaatcaacctgatcccgcattaaaatcaaatattgcc
actatgacgcaacagcaacagcaacaacaacaacaacaatcaatggaaatcgatagtgtt
actgatgaatttatagacaacaaccctaatggtttagatactagagagattgacgatatt
tctgttgataaagattatggtttaaaccaaccagaaccgatcccaatcgaagatgacaat
cagggtcaagtagtagattcagaactcgtggaagaagaagaagaagaagaagaagatgat
gacgacgacgacgacgacgatgatgatgaaattgaaggaaatgtacaaatagttgaggat
cgcggtatttccaagaataccaaaagcgcttatccactagctaatgaatttgaagatctt
gcagcaaaactaatgaaaccaattgatgactatccaataaaagatgaagcacactatgtc
tgggaaattaaagattggcattcgattttaaaagaagacaaggtcagatcaccaagattc
aaatgtggagggtttgaatggaacattctactttttccacgtggtaatacccacaacaac
caaatttctatttatatggagccacacccacccgttgatgaaaatgataaaccaatagat
gaagactggtatgtttgtgcccaatttggattggatatctggaacccacaacatccagat
gcccattcgccaagtcagagtcaccatagatttaataaaaatgagaccgactggggtttt
ggatcattgatagaattaagacagttgtccatggttagaacacctcgaaaccaatcttct
agtcatgcacttttggaaaataatcaattgaatataactggttatgttagagttattgat
gattcttccaccggtgtattgtggcataattttgttgaatatgattccaagaaaaatgca
gggtttgtcggcttgaacaatcaaggtgccacttgttatttgaattcattgttacaaagt
tatttcacaacaaaattgtttagaaagttggtgtacaaaatccccacggatctgaaatct
tcaggtgttgctttgtcattacaaagaattttctatttattaacgaaatccaacgatcct
gtgggaacattggagttaactagatcctttggttgggattcatcagatgcattcactcaa
catgatgttcaagaattgaatcgtattttaatggataaattggaaacagccatgaaagga
tctgacatcgaaggtgcattgaatgatatttttgtcggtaaaatgaaatcatacatcaaa
tgtgtcaatgtaccttacgaatcgtcaagagtggaagatttctgggatattcaattgaat
gtcaaaggtttcaaaaatcttgagcaatcatttcaaaactatattgaaattgaaatgttg
gaaggggaaaataagtatcaagctggtgatgaatatggatatcaggatgccaaaaaaggt
gttgtctttgagtctttccctcctgtattgcatttgcaattgaagcgttttgaatatgac
tttatggttgatgatttagtcaagattgacgatttttatgaatttccagataagatagat
ttaaagccatatcttgatgaagatttacctgatgatgtgaaaaaccagaattggaattat
aaattacatggggtattggtccatcaaggaagtatctcaaacgggcattactatgccatg
attaaaccaaactctagagataatacatggttacgatttgatgatgacagagtatggaaa
gtcactaaaaaggaagttttccaacaaaatttcggggcttctgatatctctcaagcacag
ttgaataaaatgactagagctgagcaacaagaacatttaatgagaagaatgacatccgct
tatatgttggtgtactatcgtgaatcagaattggacaagattttaccaacagatgattca
ttggtcgagtcagcaattcctgaacatatccccaagcaaatagagtttgagattgcggaa
cgtgagcgattggaaaagcaacgacaagaagagttgtattataccacagctaaattagtc
acaacagctaccatcaacgcacatgttggttttgatcttgcattagaccgcaccgtccac
aaattttatgatgaagagttggaaggcactgcatgcgacccagtggttttaaaagttaaa
aaggatagtaaaatgtccgaacttatcgagtcagtgggaaaaagtttgggatatgacgat
gttaacctcttccgattggttactatttgtcatagaaataaccattccaatcgattggat
gcttgtgtggaaaagaaattggagtcttataccattagtgatttttactttaagattttc
aatagaaaatatgacgaaatggtgttttatgtggaagaattgaataaagatattcgtaac
atcatccagttagtggatactgagtatattgaaccaaaagattttacatttgaacaagtt
ttcagcaaaattgaatccactggcaataagattggcgaaggaatgcgttttgaaaacact
gaagcttatgctaatcacattactatcatcatcaagtattttgatccaatttctcaggag
attagatcattatcccatatagtagttgctaaatccgatcaaatcaaaacaattattgat
cctatcaagaagttacttggatttaaagatgatgttgagttggaaatgtttgaggaattg
tcaccgtctaaagttgataagattgaccctgagttgacatttaacaagcaagaattgagt
catggcgatatactcacagttcaagttgtaaatccaggtgaattgaataaagatggacaa
tttaaggatttgagagagtattataaatttttattgactagactacatgttaatgtcagg
ccattcaaggcagacatagatgaagaagattcggattttgttgctaatgatgaggatgat
atggatcaagatggtgtacattctgaagataacgaagtaactaatgaagagattcaacgg
gccaaaaatttgagtagaagttttgatttctggatttccacaagttatagttatcatgat
ttggccaaggcaattgccgtgaaattaaatgttgatccagcttatttaagaatatttgct
ctttcatcatcaggagaaagattcccactaaaatcaaatagttatgtttcacagtatgtt
gcccgatctgttcccgtttcagcaatttttgagtttgaatatgaaatacttaatattcca
ttagttgaatatgagaatatgaaggctgttaaaatccattggcttgtcacattgttgcaa
tcacaagtatttgatgtgttggttcctaaacttggtactatcggagatgttgtcactaag
cttttacataaagtgaatgttgagaagaaggatttacctcacttgtttgtctggtctggt
agccaccataattatcaggatatgtataaggcagacactccattaaatcaaattcctgat
ggtgttgatctttactgtggtttattccctaccgaagttgaactgttgtgtcactttgat
atgtataaacgatttttcccacaagagattaaagtggatgaaattgatgcagttgataga
gaagaatttttagctgttaaagcagctggagaccaacttaatttcttacctgcgttccat
ttctacaaggcaggagattcacgtcatggaataccatttgtatttgttgtcttaccaaat
gaaccactttccgaaaccaaggaaagattaagaaagaaattagggttgggtaaacaagca
tttgataaaattagattagccttagcagatattaactttaaaggactgtatttggaaggc
aaagataatttgatattatttgatgaaattgccaataaacgtcttagtttgggacttgat
catccagatagaactccaagacgtcaaagtcaatttgataaaggtatttccatcaaataa

DBGET integrated database retrieval system