KEGG   Candida tropicalis: CTRG_02108Help
Entry
CTRG_02108        CDS       T01115                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ctp  Candida tropicalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 672 aa AA seqDB search
MSKDLIKGVLNVDPWLEPFSQQLIDRQVRFQDWYDKLTKSEGSLINFANSYKNYGLHSLP
DGNYKIVEYIPNVESVSLVGDFNNWNTESHPLKKSNDFGLWELTIPAKTIPIDSKYKIAM
KLSSGEWIYRLDPWVHRATYSEETTQYEGRFWEDNYIFKNPRPKNAAGNEIKIYEAHIGI
STPDPKVGSYKNFTQNILPIIKDLGYNTIQLMAIMEHAYYASFGYQVTSFFAASSRFGTP
DELKELIDTAHGMGIQVLLDVVHSHSSKNVDDGLNMFNGTDHYLFHGGGRGMHDLWDSRL
FNYTNYETLRFLLSNLKYYIDVFQFDGFRFDGVTSMLYKHHGLSYGFSGNYHEYFGEGVD
DEALVYLMLAHKLMDDISKTENITLTSIAEDVSGMPTLCRPITDGGIGFDYRLSMAIPDM
WIKVLKHLSDEQWDLGNIVHTLCNRRYGEKVVVYCESHDQALVGDKTIAFWLMDAEMYTN
MSVLTELTPVIDRGIALHKMIRLITYGLGGEGYLNFEGNEFGHPEWLDFPRVGNGESYHY
SRRQFNLIKDDLLRYKFLYAFDKAMLKLDVTGPEYVSLKHEGDKVLVFEKGDLLFIFNFN
SSQSFVDYKIGVEHPGKYKVVLDSDAEEFGGHQRLDDSQVYFTSDEPWNHRKNSMQVYIP
TRTALVLQLAKD
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttaattaaaggggttttaaatgtggatccatggttagaaccattctct
caacaattgattgatagacaagtaagattccaagattggtatgataaattgactaaatct
gaaggttctttaatcaattttgcaaatagttataagaattatggtttacattctttacct
gatggaaattataaaattgttgaatatatccctaatgttgaatctgtttccttggttggt
gatttcaataattggaatactgaatctcatcctttgaaaaaatctaatgattttggatta
tgggaattgactattcctgctaaaactattccaattgattcaaaatataaaattgctatg
aaattatctagtggtgaatggatttatcgtttagatccttgggttcatagagctacttat
tcagaagaaactactcaatatgaaggtcgtttctgggaagataattatatatttaaaaat
cctcgtcctaaaaatgctgctggtaatgaaattaaaatttatgaagctcatattggtatt
tctactcctgatccaaaagttggttcctataaaaatttcactcaaaatattttacctatt
attaaagatcttggctataatactatccaattgatggctattatggaacatgcttattat
gcttcttttggttatcaagttactagttttttcgcagcttcttcaagatttggtactcct
gatgaattgaaagaattgattgatactgctcatggaatgggtattcaagttttattagat
gttgttcattctcatagttcaaaaaatgttgatgatggtttgaatatgtttaatggtact
gatcattatttattccatggtggtggcagaggtatgcatgatttatgggattctcgttta
tttaattacaccaattatgaaactttaagattcttgttgtctaatttgaaatactacatt
gatgtcttccaatttgatggtttcagatttgatggtgttaccagtatgttgtataaacat
catggtttatcttatggtttcagtggtaattatcatgaatattttggtgaaggagttgat
gatgaagctttggtgtatttgatgttggctcataaattaatggatgatatttccaagact
gaaaacatcactttgacttcaattgccgaagatgtttccggtatgccaacgctatgccga
ccaattactgatggtggtattggttttgattatagattatccatggccattcctgatatg
tggattaaagttttaaaacatttgagtgatgaacaatgggatttgggtaatattgttcac
actttatgtaaccgtagatatggtgagaaagttgtggtttattgtgaaagtcatgatcaa
gctttagttggtgataaaaccattgccttttggttgatggatgcagaaatgtacaccaac
atgagtgttttaaccgaattaactccagttattgatcgtggtattgctttacataaaatg
attagacttattacttatggtttgggtggtgaaggttatttgaatttcgaaggtaatgaa
tttggtcatccagaatggttggatttcccaagagttggtaacggtgaatcttatcattac
tcaagaagacaattcaacttaattaaagatgatttacttagatataaatttttatatgca
tttgataaagccatgttgaaattagatgtcactggtccagaatatgtttcccttaaacat
gaaggtgataaagttttagtctttgaaaagggagacttacttttcatttttaatttcaat
tcttcccaatcatttgttgattataaaattggtgttgagcatccaggtaaatataaagtg
gtcttggactccgatgctgaagaatttggtggacatcaaagacttgatgatctgcaagtt
tacttcacttctgatgaaccttggaatcatagaaagaattctatgcaagtttatattcct
actagaacagcccttgtattacaattggccaaagactaa

DBGET integrated database retrieval system