KEGG   Candida tropicalis: CTRG_02178Help
Entry
CTRG_02178        CDS       T01115                                 

Definition
similar to glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ctp  Candida tropicalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTRG_02178
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CTRG_02178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MRSFRLLSFTIFIFQFNFINSLFIPFQYPPQSLFSYGSSSNTASIPNSFEDWLIYQEDVC
LRSILNNIGGDFTTDKDLLPGVIIASPSKENPNYYYQWTRDAAITLNLITEQVYLNPKNH
SLINIIESYIENTLILQKIPNRSGSVEDYGNLGEPKFETNLTNYNGNWGRPQRDGPALRA
ISIMNYLNVLYEYSLPVEKQSTLYNSSFIYYEAIKPDLIYTIKYWHEKGFDLWEEIYDYH
FFTSLVQLKSLSLGLKYAKLFNDSIEFQNELSETINNLLNFINHDSGFINPFKPYIVSGP
SLYHIGKRNGLDIATILASLYTHEDNETSIPFNIDNGYILTTLSSLISDMKFRYPINFQD
NFLGVALGRYPEDIYDGYHQTEGNPWFISTSTASELIYKLIKDLKTNKKDIIINNSNIDF
FKIFLPLDNSNNSNDENDNDDNDDNDDNDQFEELIIKYNSKSYLLMIDKMFNYADGFLKV
VHKHIGSNGELSEQFNKINGYMQGASELTWSYGAVHQAIIARKRLL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatttcgtttattgtcatttacaatatttatatttcaatttaatttcataaat
tcattatttatcccatttcaataccccccacaatctttattttcttatggtagtagtagt
aataccgcttcaattcctaattcatttgaggattggttaatttatcaagaggacgtgtgt
ttgaggtcaattttaaacaatataggaggtgatttcacaactgataaggatttattacca
ggggttataattgcttcaccatctaaagaaaatcccaattattattatcaatggactaga
gatgcagcaattactttaaatttaataactgaacaagtttatttaaatcctaaaaatcat
tcattaattaatataattgaatcttatattgaaaatactttaattttacaaaaaattcca
aatagatctggctctgttgaagattatggaaatttaggtgaacctaaatttgaaaccaat
ttaactaattataatgggaattggggtagaccacaacgtgatggaccagcattaagagct
atttcaataatgaattatttaaatgtattgtatgaatattcattaccagttgaaaaacaa
tctactttatataattcaagttttatttattatgaagccataaaacctgatttaatttat
acaattaaatattggcatgaaaaaggatttgatttatgggaagaaatttatgattatcat
tttttcacatctttagtacaacttaaaagtttatcattaggtttaaaatatgctaaactt
ttcaatgattcaattgaatttcaaaatgaattgagtgaaactattaataatttattaaat
tttataaatcatgattctggttttataaatccatttaaaccttatattgtttccggtcct
tcactttatcatattggtaaaagaaatggattagatattgctacgattttagcaagttta
tatactcatgaagataatgaaacttcaattccttttaatattgataatggttatatctta
actactttaagttctttaatatcagatatgaaatttagatatcctataaattttcaagat
aattttttgggggttgcattaggaagatatcctgaagatatttatgatggttatcatcaa
actgaaggaaatccttggtttataagtacttcaactgcaagtgaattaatttataaatta
attaaagatttgaaaacaaataaaaaagatataattataaataattcaaatattgatttt
ttcaaaatttttcttccattagataattccaataattcaaatgatgagaatgataatgat
gataatgatgataatgatgataatgatcaatttgaagaattgataattaaatataattca
aaaagttatttacttatgattgataaaatgtttaattatgctgatggttttttgaaagtt
gttcataaacatattggttcaaatggtgaattaagtgaacaatttaataaaattaatgga
tatatgcaaggtgcttcagaattaacttggagttatggtgctgttcatcaagcaattata
gcaagaaaaagattactataa

DBGET integrated database retrieval system