KEGG   Candida tropicalis: CTRG_02257Help
Entry
CTRG_02257        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CTRG_02257
Transfer RNA biogenesis [BR:ctp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CTRG_02257
Chromosome and associated proteins [BR:ctp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CTRG_02257
   HAT complexes
    Elongator complex
     CTRG_02257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 8296960
NCBI-ProteinID: XP_002547960
UniProt: C5M9U5
Position
Unknown
AA seq 547 aa AA seqDB search
MAVQKNKVPEKERFIQCCGDISLELVASLKSSKDINLNGLITRYAKKYKLRQQPRLTDII
SSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFE
YSTQSYTGYEPTSMRAIRARYDPYEQARGRIDQLRSLGHSIDKVEYIIMGGTFMSLPIDY
REGFITQLHNALTGFNEKNIDEAIEFSQQSQTKCVGITIETRPDYCTETHLSDMLKYGCT
RLEIGVQSVYEDVARDTNRGHTVKSVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLEQF
KEYFENPEFRTDGLKLYPTLVIRGTGLYELWKQGLYKSYNANALIDLVARIMALVPPWTR
IYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHKVIPDQVE
LIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTSQPTSIVRELHVYG
SVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSEKISVISGVGVRNYYAKLGYELDG
PYMSKKL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcaaaagaataaagttccagaaaaggaaagatttatccaatgttgtggtgac
atttcattagaattagttgcatcacttaaatcttcaaaagatataaatttaaatggatta
attacaagatatgctaaaaaatataaattacgtcaacaaccaagattaacagatattatt
tcaagtatacctgatcaacataagaaatatttaattcctaaattaaaagcaaaaccagtt
agaactgcatcaggtatagctgttgttgcagttatgtgtaaacctcatagatgtcctcat
attgcatatactggtaatatttgtgtttattgtcctggtggtcctgattcagattttgaa
tatagtactcaatcttatactggttatgaacctacttctatgagagctattcgtgccaga
tatgatccttatgaacaagcaagaggtagaattgatcaattaagatcattaggtcattca
attgataaagttgaatatattattatgggtggtacatttatgtctttacctattgattat
agagaaggttttattactcaattacataatgcattaactggatttaatgagaaaaatatc
gatgaagctattgaatttagtcaacaatctcaaactaaatgtgttggtattactattgaa
acaagacctgattattgtactgaaactcatttaagtgatatgttaaaatatggctgtact
agattagaaattggggtacaatcagtttatgaagatgttgcaagagatactaatagaggt
catactgttaaatcagtttgtgaaacttttgctgttgctaaagatgcaggttataaagtt
gtttcacatatgatgcctgatttaccaaatgttggtatggaaagagatttagaacaattt
aaagaatattttgaaaatcctgaatttagaactgatggtttaaaattatatccaacttta
gttattagaggtactggattatatgaattatggaaacaaggattatataaatcttataat
gcaaatgcattaattgatttagttgctcgtataatggcattagttccaccatggactaga
atttatcgtgttcaaagagatattcctatgccattagttacttcaggggttgaaaatggt
aatttacgtgaattggcccttgcaagaatgaaagattttggtacaagttgtagagatgta
cgtactagagaagttggtattcaagaagttcatcataaagttattcctgatcaagttgaa
ttaattcgtcgtgattattatgctaatggaggttgggaaacatttttaagttatgaagat
ccaaaacaagatattttaattggtttattaagattaagaaaagcaagtaaaaaatatact
tatcgtaaagaatttacttctcaaccaacttcaattgttagagaattacatgtttatggt
tctgttgttcctttacattcaagagatcctagaaaattccaacatcaaggttttggtact
ttattaatggaagaagctgcaagaattgctaaagaagaacatggttctgaaaaaattagt
gtcatttctggtgtgggtgttagaaattattatgctaaacttggttatgaattggatggt
ccttacatgtcaaagaagttataa

DBGET integrated database retrieval system