KEGG   Candida tropicalis: CTRG_02326Help
Entry
CTRG_02326        CDS       T01115                                 

Definition
similar to arginase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ctp  Candida tropicalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CTRG_02326
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CTRG_02326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MQRLISDPCVTYTIQIPIQKYTLLLSFFFIIIVIFFLSIIFCVERNKFPLRELIARSAIP
QEYKMGFNFPEMKNRTNWVYTPMKLLILSMIGLVSGQAIFRTSSSSLLDQLYGEIVDLTP
TFDTTSADTDRVLAMRSKLTLPDKDDTSDIAADQNIFGGILTFAHLDHFNCFVSQDENPA
MDIAIVGAPFDTGTSYRPGARFGPQAIRNAAARLTGSSKSKHKRAGYPVDPYDGNTHNYS
IIDCGDVAMTPFDNRIALNQLYRGHRSISKHTGNVHSTPRIITLGGDHTITLMAIKNAHE
SLGAKVRVLHFDSHIDTWDPKVLGGGITDYMSLNHGTFLHYAHELGYIQRSGNYHVGIRA
PYIDASYDKNHDNECGFNTIHANDIDKIGVHGIIRELSHEPDTPTYISVDIDVLDPAYAP
GTGTMEAGGFTTRELLSILDGLKGHVNLIGADVVEVSPPYDTNSGITSLAATSVVDSLLK
LMVV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacttataagcgatccctgcgttacatatacaattcagatacctattcagaaa
tatacattgttattgtcttttttttttattattattgttattttttttttgtctataatt
ttttgtgtggagcggaataaatttcctctaagagagcttatcgctaggagcgcaatcccc
caggaatataaaatgggattcaactttcctgaaatgaaaaatagaacaaactgggtatac
acaccaatgaagttactcatcctatccatgattggcttggtctcggggcaggcaattttc
agaacatcactgtcatcactccttgaccaactatacggtgagatcgtggacctcactccg
acattcgacaccaccagtgccgacacagacagagttcttgctatgagatccaagttgacc
ttgccagacaaggacgacacctcggacattgctgctgaccaaaatatctttggtggaatt
ctcacatttgcacatttggaccacttcaactgttttgtcagccaggatgagaacccagcc
atggacattgccattgtgggtgcaccattcgacacgggaacatcgtaccgtccaggagca
cggtttggaccacaggctattagaaacgctgctgcccgtttgacaggctcactgaaatca
aaacacaagagagctggttaccctgttgatccatacgacggcaacacccacaactattcc
atcattgattgtggggatgtggccatgaccccgttcgacaataggattgcgttgaaccag
ttgtaccgtggacacagaagtattctgaagcacactggtaatgttcactccacgcctagg
atcatcactctaggaggcgaccataccatcaccttaatggcaatcaagaatgcacatgag
ctgttgggagccaaagtcagggtgttgcatttcgattcacatattgatacgtgggatccc
aaggtgcttggtggcggcataacggactacatgtcgttgaaccacggcacgttccttcac
tatgcacacgagttggggtacatccagagaagcggtaactaccatgtcggtattcgagca
ccatacattgatgccagctacgacaagaaccacgacaatgagtgtggattcaacaccatc
catgcaaatgacattgacaagattggtgtgcatggaatcatccgtgagttgtcccacgag
cctgacacgcctacttacatctcggtggatatcgatgtgttggacccagcgtatgctcca
ggtacgggaacaatggaagcaggggggttcaccaccagagagttgttgagtatccttgac
gggttgaagggccatgtgaacttgatcggtgcggatgttgttgaagtgagtccgccatat
gacaccaacagcgggatcactagtttggcggccacaagtgtggtggactcgctcttgaag
ttgatggttgtgtag

DBGET integrated database retrieval system