KEGG   Candida tropicalis: CTRG_02427Help
Entry
CTRG_02427        CDS       T01115                                 

Definition
cytochrome c peroxidase, mitochondrial precursor
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CTRG_02427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MASIAANIGKVSKNSTRLNYGRFAKVFLGVAGSTAIATYFYNSNNNNNNKNGNSSSNKTL
MSLFGGTVPNMKLAKVPDGKTQEDYQKVYNAIATKISENLEFDHNDGFYGVLVRLAWHNS
GTYDKSDNTGGSYGGTMIFSPEEFDPENAGLQIGRAFLEEFLVRYPWISRGDLWTLGGVC
AVQESGGPSISWSPGRVDQTTNVPPNGRLPDASKDAEYVRKIFDRQGFNDREIVALLGAH
VLGRCHRHFSGYDGAWGPSFNAFTNTFYTMLLGDWHVKKWDGKKQYEDDETNEFMMLPTD
MALKEDSNFLKYVKMYAEDQDLFFEDFAKAFSKLLSNGIQYPAGTKPMIFKTLDEQDES
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattgctgcaaatattggtaaagtctccaagaattcaactaggctcaattac
ggcagatttgccaaagtatttttaggggttgctggttcaaccgcaattgctacgtatttc
tacaacagcaacaacaacaacaacaacaagaatggcaattcttcttctaacaagacattg
atgtctttgtttggtggtactgttccaaacatgaaattggccaaggttccagatggaaag
actcaagaagactaccaaaaagtctacaatgctatcgctactaagataagcgaaaatttg
gaatttgatcacaacgatgggttctacggggttttggttagattagcttggcacaattct
ggaacttatgacaagtccgacaacactggtggttcttacgggggtactatgattttctcc
ccagaagagtttgaccctgaaaatgctggtttacaaattggtcgtgcattcttagaggag
tttttggttaggtacccatggatttcacgaggcgacttgtggaccttgggtggcgtttgc
gccgtccaagagtctggaggtccctccatcagttggagtccaggaagggtggatcaaacg
accaacgtcccacccaatggtcgtcttccagatgcctctaaggatgcagaatatgtccga
aagatttttgaccgccagggtttcaacgatagggaaatcgtagctcttcttggggcacac
gtccttggccgttgtcaccgccacttctctggttatgatggtgcatggggtccctctttt
aatgcttttactaacaccttttataccatgttgttgggtgattggcatgttaagaaatgg
gatggtaagaaacagtatgaagatgatgaaaccaacgaatttatgatgttgccaactgat
atggctttgaaggaagattccaactttttgaagtatgtcaagatgtatgctgaggatcaa
gatttattctttgaagactttgccaaggctttctctaaattgctttctaatggtattcaa
tatcctgctggtaccaaaccaatgatcttcaagacattggatgaacaagatgaatcttaa

DBGET integrated database retrieval system