KEGG   Candida tropicalis: CTRG_02447Help
Entry
CTRG_02447        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CTRG_02447
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_02447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 517 aa AA seqDB search
MFFSKRILIFLIINFTLFLQLFKLTLFTKNKLIATVSTSILVLFSLYYLTASTLGPKFSS
AFNIIPKYLRNIMNYSRFGNGNGNYSRFSKQNSEERELALKNGGLVGGLSNDGNTCFMNS
VIQALASSEEFLKFIDSYLYLDIELDKKPNGEPLTIRSNQPKPELVFTNALKTLMDNLNG
KYGSQGKTFDTKKLLAKMPNGPKKNFFLGYNQEDAQEFYQLVMSLLEKEYKQINTSRLPT
PEPDANSNKFVDIRELKDKTPKNTVYVPAAEVDPNLEDAEHKVMPLELITPVDGISAEKV
SCQTCGEIGGTRFNVISGLSLNLGNNYSSVSLDDLLADWFKPEVIHEVNCNRCSLVETKE
FLESKLKDLKDNEKLSEQFEARLSQVDECLSYPMVSDQVVEKLTIKKVKRTKEKVTSLHT
LPKLLTVHINRSCFDPRSCSIVKNQAAILIPKLLYSDHYSLVAVICHFGSHHYGHYIIYR
KIHGLFYRISDEVVYPVSEEEVLNAQGAYMFFYELCN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtttttttctaaaagaattcttatattcttaattatcaattttacattatttttacaa
ttattcaagttgactttatttaccaagaataaactaattgctaccgtttcaacatcaatc
ttagtcttattttcattatactacttaacagcatcaacattaggtcccaaattctcatca
gcattcaatataatcccaaaatatttacgcaacattatgaactattcaagatttggaaac
gggaatggaaattattcaagatttagtaagcaaaattccgaagagagagagttggctctt
aaaaatggaggattagttggtgggttaagtaatgatgggaatacatgttttatgaattct
gttattcaagcattggcttcttcagaagaatttttaaaattcattgattcttatttgtac
cttgatattgaattagataaaaaaccaaatggtgaaccattaacaattagatcaaatcaa
ccaaaaccagagttggttttcactaatgctttgaaaactttgatggataatttaaatggg
aagtatggtagtcaagggaaaacatttgatactaagaaattattagcaaagatgcctaat
ggtccaaaaaagaatttctttttaggatataatcaagaagatgcccaagagttttatcaa
ttggtaatgagtttattggaaaaggaatacaagcaaatcaacacgtctagattacctact
cccgaaccggatgcaaatagtaacaagtttgttgatattagagaattaaaagataaaact
ccaaaaaatactgtctatgttcctgcagcagaagttgatccaaatttagaagatgctgaa
cataaagtcatgccattggaattgatcacccctgttgatggtatttctgccgaaaaggtt
ctgtgtcagacctgtggagaaatcggaggtaccagattcaatgttatcagtggattgagt
ttgaacttgggtaataactattcgagcgtaagtttggatgatttattggccgattggttc
aaaccagaagttattcatgaagttaattgtaaccgttgttcattggtagaaacaaaagaa
tttttagaatccaaattgaaagatttaaaggacaatgaaaaacttagtgaacaatttgaa
gcaagattatctcaagtagatgaatgtttgagttatccaatggtatcagatcaagtagtg
gagaaattaacaatcaaaaaagttaagagaactaaagagaaagttacatccttgcacaca
ttgcctaaattactaacagttcatattaacaggagttgctttgatcctagatcatgttct
attgtcaagaaccaggctgctattttaattcctaagttgttatatagtgaccattattct
ttagtggcggtcatctgtcactttggtagtcatcattatggtcactatataatctataga
aaaattcatggcctcttttatagaatatctgatgaggttgtctatcctgttagtgaggaa
gaagttttgaacgctcaaggtgcttatatgttcttttatgaattatgtaattaa

DBGET integrated database retrieval system