KEGG   Candida tropicalis: CTRG_02454Help
Entry
CTRG_02454        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ctp  Candida tropicalis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CTRG_02454
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CTRG_02454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MTSKKTNEVLNMNQKESVLSEEDQKYHDSFLALIERNQIPLSRNLLILLYSLHFFTKNSN
IIHQYTTKFIKLQNAIGFDETTGKMIYDIDISDAFNVFHWIIVITFLRSFLMKYCFEPFA
SRFCDIHSKKAKTRFAEQSWSFTYYTFSFIYGVYLYWHSPYFNNLDQVYINWPNHSMFFE
FKSYYLISMGFWLQQIFVLNVEKPRKDHYQMFSHHIITCLLMVGSYYYYFYRIGHLILML
MDSVDIALSGAKMLKYAGFPTACDAMFIVFLVSWIVLRHGLYNYIYVHTWNNATTLMASG
RCVEGYTQKRCWTPALIDYFMGLLGGLQIITCIWMYLILKVAYKVITGKGAEDVRSDEDD
TDIESVNEAEEADCEDEEEVQKNVVDEDDEDDEIEEEELFDEEKIIDDRDSLSSSSETTL
DEKKERKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaaaaacaaatgaagtgctaaatatgaatcaaaaggaatctgtactttct
gaagaagatcaaaagtatcacgattcatttttagcattgattgaaagaaatcaaatccct
ttgtcaagaaacttgttgattttattatattctttacattttttcaccaagaattccaat
ataatccatcagtacactacaaaattcatcaaattgcaaaatgccattggatttgatgaa
actactggtaaaatgatttatgacattgatataagtgatgcctttaatgtgtttcattgg
attattgttattactttcttaagatcatttttaatgaaatattgttttgaaccatttgct
tctagattctgtgacattcatagtaaaaaggctaaaactagatttgcagaacaaagttgg
tctttcacttattatacatttagttttatctatggggtttatctctattggcattctcct
tatttcaataatttagatcaagtttatatcaattggccaaatcattctatgttttttgaa
tttaaaagttattatttgatatctatgggtttttggttgcaacaaatttttgttttaaat
gttgaaaaaccaagaaaagatcattatcaaatgtttagtcaccatattatcacttgttta
ttaatggttgggtcctactactattatttctatagaattggtcatttgattttgatgttg
atggatagtgttgatattgccttgagtggcgctaagatgttgaagtatgctggattcccg
actgcttgtgatgctatgtttattgtattcttggtcagttggattgttttgagacatggt
ctttataattatatttacgtccacacttggaacaatgctactactttgatggcctctggc
agatgtgttgaaggctacacacaaaagagatgttggacccctgctcttattgattacttt
atgggtttattaggtggtttacaaattatcacctgtatttggatgtatttgattcttaaa
gttgcttacaaggtcatcactggtaaaggtgccgaagatgtcagaagtgatgaagacgat
actgatattgaatctgtcaacgaagccgaggaagcagactgcgaagatgaggaagaagtg
cagaagaatgttgtcgatgaagatgatgaagatgatgaaatcgaagaagaagaattattt
gatgaagaaaagataatcgatgatagagattctctcagttcttcatcagaaactactctt
gatgaaaagaaagagagaaaagcataa

DBGET integrated database retrieval system