KEGG   Candida tropicalis: CTRG_02511Help
Entry
CTRG_02511        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ctp  Candida tropicalis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTRG_02511
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CTRG_02511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 557 aa AA seqDB search
MEISPANIKEQSRSRSRSRTRNSTANSRSTSASRRSSLSSLHRRSLSSSSLNRLTITTTQ
VDQERSVPSVQVYLDNSLPLDFFKQDIIALTKTLRISKWHKRQLLAQHLTVNRISGALTN
SIYKLEYHDEAQNIHLPALLLRVYGKNVDELIDRDNELAILVKLSQKRIGPRLLGIFSNG
RFEQFLDGFVTLNKEQIRDKVLSQMLGRRMKDLHYKIELDSHDFTAEPTCWKLIEKWLRI
FETELLPGYLQANYDPKNVFVVEFSKFKEYVAKYKEWLFNKYDTEHFLSNYKFCHNDTQY
GNLLLHESFNPEDVLIESLSIDGEVASSHKKDANLVVIDFEYSGANFPAFDIVNHFSEWM
SDYHDPEKSYFIHNKNFPTKSEQLNMIKSYVEYDFQYPSSNLKTSKKPEELFNNSTDPVP
LMEFEIEKLYNECIYWRASVQIFWCLWGLIQNGPIRPQLHSNGSEQGINSTYNFTVDGDT
DESSPRNSTVVTVDKNGATEVEIITSSDDEFDYLKYANQKVDLILGDLIQFGIVDKKDID
EKHLQDIKYLDTKAFDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggagatatcaccagctaatattaaggaacaatcaaggtctagatcaagatcgagaaca
agaaattcaacggcaaattcaagatctaccagtgcatcaagaagatcaagcttatcatca
ttgcatagaagatcattatcatcatcttctttgaatagactcactatcaccacaactcaa
gtagatcaagaacgttcagttccttcagttcaggtttatttggataattcattaccttta
gatttctttaaacaagatatcattgcattaaccaaaactttgcgaattagtaaatggcat
aaacgtcaattattggctcaacatttgactgtgaatagaatatcaggtgcactaactaat
tctatttataaattagaataccatgacgaagctcagaatatccatcttcctgcactttta
ttaagagtttatggtaaaaatgtcgacgaattgattgatagagacaatgaattggcaatt
ttggttaaattatcccaaaagagaataggtccaagattattggggatattttcaaatggt
agatttgaacaatttttagatggatttgttactttgaataaagaacaaattagagataaa
gtcctctcacaaatgttgggcagaagaatgaaagacttgcattataaaattgaattggat
agtcatgattttacagctgagccaacttgttggaaattgattgaaaaatggttaagaatt
tttgaaactgaattattacctggatatttacaagcaaattatgatccaaaaaatgttttt
gtggttgaattttccaaattcaaggaatatgttgccaagtataaagaatggttgtttaac
aagtatgacactgagcattttctttccaactataaattttgtcataatgatacccaatat
ggtaatttgttattacatgaatcattcaacccagaagatgttctcattgaatcgttgtcc
attgatggagaggtggcttcttcacacaagaaggatgcaaatttagttgtcattgatttt
gaatattctggtgctaatttccctgcatttgacattgtaaatcatttctcagaatggatg
tcagattatcatgatccagaaaagtcatactttatccacaacaaaaatttcccaaccaag
tcagaacaattaaacatgatcaaatcatatgttgaatatgacttccaatatccttcctca
aacttgaagacatccaaaaagccagaagaacttttcaacaattcaacagatccagtacct
cttatggaatttgaaattgaaaaattatacaatgagtgtatctattggcgtgcatctgta
caaattttctggtgtttatgggggttgattcaaaatggtccaataagaccccaattacac
tccaatggatctgagcaaggtatcaatagtacttataatttcactgttgatggcgataca
gatgaatctagtcctcgcaatagcactgttgtaactgttgataaaaatggtgctacagaa
gtggaaatcatcacttcaagtgatgatgaatttgactatttaaaatatgccaatcaaaaa
gtcgacttgattttgggagatcttattcaatttggaattgttgataagaaagacattgat
gagaagcacttgcaagacatcaaataccttgatactaaagcttttgatttatag

DBGET integrated database retrieval system