KEGG   Candida tropicalis: CTRG_02618Help
Entry
CTRG_02618        CDS       T01115                                 

Definition
similar to potential cyclic nucleotide-binding phospholipase
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ctp  Candida tropicalis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ctp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1398 aa AA seqDB search
MNKTALTGPVNTVVDSTKMAAKGYDLFSMISHVLVVAQRLMFQILNFLVIEIPAFFIRLL
AIDFQFSLHLSSILLIVLCFGIFVFFVLRYKYLNSYSIPDKSTGQDFNRPNVFMEKSKSV
KNPTNYLSQFMQGIKVFGYLEKSVFHELTKSMYTQKLTMNEVMILDESVGFSVVVEGVAQ
VYTKVSKETPVNSGGIDTEYFEDAGTQTDEFLTVGKKQYQLLNEVKSGTPLSSLFSTLEL
FQPKRNVMFTPREEDENSVVALNLDYTGNSGNAQPTHLEDPNYEEYPEIIIRPKKLHNYD
TVTIAIIPQSAFERVHSKYPKATSRIVAMVLTRLYKVTLNTLHNYLGLTGEVLKSEIKLN
ENSGSTNLPKHLVDGLLQRLSRANAAQEDNLPKKTKHHHRQALQRTSSRYVLLGSKLTNN
NPGDLLSSVPISRDGFVNKSLSKSSTTTLSSDAESGKTARRTNFTDEIEETEENSLRVAI
VENIFKIIGIKDQNGYMVDNSADYHSLNSSTNSSMIGLSQSVLSMPSVRPPLSLRHSGNL
MNTINLSELNNRSATASPSSPSSSPSPIREVDTSATPKREILTKKRHISDMSIKDEFANH
LEIRNIEANTTIVQQDSITAGLYYVIDGELEVYHHSSEANSPNKYVYSVRSGGIAGYLTS
VVGSRSLVTIKTPKKTGAVVAYLSKNHYNSLLDKYYFLQLPVALGLKNLLSKQIITIDYA
LEWCHIPAGEVLFSQGDSANGFHVVLSGRFRAIRKVGASDIRSHDKDFQILGEYGHGESI
GEVEVLTATKRSHSLVAVRDSETARIPRSLFEMLANENPSIMVKVSRLVASKVLLQGNEP
PTRGFVTSSSSKAYTCTDYKTITILPTVAGLPVRQFAEKLVNALKLIGRNVIALDQASML
THLGRHAFDESLSRLKMSGYFAYLEEEYETIVYICDTAVQSNWTSTCISQGDCILLLADA
DEENNGVGEYEQLLVKLKNTARTDLCLIHQEKSVTPGSTSPWLKNRIWVQGHHHIEMRFE
RGGSHLPSKKSFISDLANKISQNKTIKSTYEATKQHIRWYLSDENRNKAMKMHKDDFMRL
ARILSNEAVGLVLGGGGSRGISHVGVVTALERHGIPVDIIGGTSIGSFVGGLYAKEYNIV
SIYAMAKKFSKRVSSLWRMIFDLTYPVTSYITGYEFNRGIWKVFGFTEIEDFWIKYYCNS
TNITNSTMDIHETGYAWRFIRASMSLCGLLPPITFKGCMLLDGGYLDNLPVLEMKKRGVK
HIIAVDVGSADDRTPMNYGDTLSGFWVLFNRWNPFSKHPNVPSMMEIQLRLTYVSSVNAL
EEAKRTADVYYLRPPIDGYATLDFGKFDEIYNVGLKYADELITEWKCNNKVPPIAGLVEK
NHTKQDENKRILYRRNSV
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactgcattaaccggaccagtaaacactgtggtggatagcacaaagatggcg
gcgaaagggtatgatttgttttctatgattagccacgttctcgttgttgcacaacgatta
atgttccaaatattgaattttctagttatcgagatcccagctttttttataaggctacta
gccattgactttcagttttcattgcatttatcctcgatattgttgattgtgctttgtttt
gggatttttgtattctttgtactaagatacaagtatctcaacagttacagtatcccagat
aagtctacaggccaagactttaaccgtccaaatgtatttatggagaaatctaaactggtc
aagaatcctacaaattatctatcacagtttatgcagggaataaaagtgtttggatattta
gaaaaatctgtgtttcacgaattgactaaaagtatgtacacgcagaagctaactatgaat
gaagtgatgatacttgatgagtcagtgggattcctggttgtggttgaaggtgtagctcaa
gtatacacaaaagtatcaaaagaaacaccggtcaatagtggcggtatagatacagaatat
tttgaggatgcaggaacccaaacggatgagtttttgactgtggggaagaagcagtaccaa
ttgttaaacgaggtcaaaagtggtacaccattaagttcattattctcgaccttggaatta
ttccagcccaaaagaaatgttatgtttacacctcgagaagaagatgagaatagcgttgtt
gccttgaacttggactacacgggaaattcgggtaatgcacaacccacacacctcgaggac
ccgaactatgaagaatatccggaaattattatcagacccaaaaagctacataactatgac
acagtcaccattgcaatcatcccacagagtgcttttgaaagagtccattcaaaatatcca
aaggcaacgtctcgtatcgtggcaatggttttaactaggttgtacaaggtgaccttgaac
actcttcataattatcttgggttgacgggtgaggtgttgaaactggaaatcaagttaaat
gaaaatagtggcagcacaaacttgccaaaacatttggtggacgggttattacaaaggtta
agtagggccaatgctgcacaagaagacaacttaccgaaaaagacaaaacaccatcatcga
caggcccttcaaagaacttcgtctagatacgttttgttaggctctaaattgacgaataat
aatccgggagatcttttatcgtcggtaccaatttctcgagatggtttcgtgaataaatcg
ctttcgaaatcctcaactacaactttgtcactggatgctgaaagtgggaaaactgctaga
agaacaaatttcactgacgagatagaagaaactgaagagaattcgttacgtgttgcaatt
gttgagaatatttttaaaataattggcatcaaggatcagaacgggtatatggttgacaat
tctgctgattaccacagtttgaattcttctacaaatagctccatgattggattaagtcaa
tctgttttgtctatgccttcagtaagaccacccttgtcattaagacacagtgggaatttg
atgaatacaattaatttatctgaactaaataacagatcggcaactgcctcaccactgtct
ccatcatcttctccatctccaatccgggaagttgatacttctgccactccaaaaagagaa
attcttaccaagaaacgccatatttcagatatgagcatcaaagatgaatttgcaaaccat
ttggagattagaaacatagaggcaaacactaccattgttcagcaagattcaatcactgcc
gggctttattatgttattgatggtgagttagaggtctaccaccactcttctgaagcaaat
tcacctaacaagtatgtttattccgtgagatctggtggaattgctggatacttgacttct
gttgtgggatcaagatcgttggttacaatcaaaacaccaaaaaaaactggagctgttgtg
gcatatttatcaaagaatcattacaattcgttattagacaagtactactttttgcagtta
cctgttgctcttggattgaagaatttattgtccaagcagattatcaccattgactatgct
ttagaatggtgtcatatccccgcaggggaagtgcttttttctcaaggggattcggcgaat
gggttccatgttgtattaagtggaaggtttagagccatccgaaaagtaggggcaagtgat
atacgaagtcatgataaagatttccaaatattgggtgaatatggacatggtgagtctatt
ggggaagttgaagttctaacagccacaaagagatcccattcacttgttgctgttagggat
tctgaaacagctcgtattcccagatcattatttgaaatgttggccaatgaaaacccttcc
ataatggtaaaagtatcacgacttgttgcatcaaaagttttattacaaggtaacgagcct
ccaactagaggatttgttacatcatcatcgtcaaaagcatatacgtgtactgattacaaa
acaatcacgatattgccaacagtggccgggttgccagtgagacaatttgcagaaaagctt
gtcaatgcattaaaactaattgggaggaatgtgattgcattagatcaggccctgatgtta
acgcatttgggccgacacgcgtttgatgagagcttgtcaaggttgaaaatgctgggttat
tttgcatatttggaagaggaatatgagactattgtttacatttgtgatactgcggttcaa
tctaattggacatcgacttgtatctcacaaggagattgtattttgttgctagcagatgca
gacgaggaaaataatggtgttggtgagtatgagcaattgttggtcaaattaaagaacact
gcaagaaccgatttgtgtttgattcaccaagaaaaatcagttactccgggatctacaagt
ccttggttgaagaatagaatttgggttcaagggcaccaccatatcgagatgagatttgag
cgtggtggttcacatttgccaagtaaaaaatcgttcatcagtgatttagctaataaaatt
tcacaaaataagaccattaaatcgacttacgaagctaccaaacaacacatccgttggtat
ttaagcgatgagaatcggaacaaagctatgaaaatgcacaaggatgattttatgcggtta
gccagaattttgtccaacgaagctgtcggtttagtattgggaggtggtggttctcgtggg
atttcacatgtcggggtagttactgcattggaaagacacggaataccagtggatattatt
gggggtacttcgattggatcctttgttggtgggttgtatgcgaaggaatacaacattgtt
tcgatctatgcaatggcaaagaagttctccaagagagtttcatctctttggagaatgata
tttgatttgacgtatccagtcacttcatacatcacaggttatgaattcaatcgaggaatt
tggaaagtttttgggttcacggagattgaagatttctggatcaagtactactgtaactcc
accaacattaccaattctacaatggatatacatgaaactggttatgcatggcgatttatc
cgtgcttctatgtctctttgtgggttgcttcctcctattacgttcaaaggatgtatgttg
ttggatgggggatacttggataatttgccagtacttgaaatgaagaaacgtggtgttaaa
catataatagctgttgatgtgggatcagcagatgatcgtacaccgatgaactatggtgat
acgttgctgggattttgggttttgttcaacagatggaatcccttttctaagcacccaaac
gttccaagtatgatggaaattcaattgagattgacctacgtgtctagtgttaatgctttg
gaagaggcgaagagaaccgctgatgtatactatttgcgtccgcctatagatggatatgcc
acattagattttggtaagtttgatgagatatataatgttggattgaagtatgctgatgaa
ttgataacagagtggaaatgtaacaacaaagttccaccaattgcaggtttagttgagaag
aatcatacaaaacaagatgaaaacaagaggatattgtataggagaaactctgtttga

DBGET integrated database retrieval system