KEGG   Candida tropicalis: CTRG_02624Help
Entry
CTRG_02624        CDS       T01115                                 

Definition
histone H2B.1
Orthology
K11252  
histone H2B
Organism
ctp  Candida tropicalis
Brite
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CTRG_02624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTEGGKKRTKARKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagcagaaaagaaaccagcttccaaagctccagctgaaaagaaaccagct
gccaaaaagaccgcttccactgaaggtggtaaaaaaagaaccaaggctagaaaagaaact
tactcctcatacatttacaaagttttgaaacaaacccacccagatactggtatttctcaa
aaagccatgtctattatgaactcctttgttaatgatatctttgaaagaattgcttctgaa
gcttctaaattagctgcttacaataagaaatctaccatttctgctagagaaatccaaacc
gctgttagattgatcttgccaggtgaattggctaaacatgctgtttccgaaggtaccaga
gctgtcaccaaatattcatctgcttctaattag

DBGET integrated database retrieval system