KEGG   Candida tropicalis: CTRG_02624Help
Entry
CTRG_02624        CDS       T01115                                 

Definition
(RefSeq) histone H2B.1
  KO
K11252  histone H2B
Organism
ctp  Candida tropicalis
Brite
Chromosome and associated proteins [BR:ctp03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CTRG_02624
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CTRG_02624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W
Motif
Other DBs
NCBI-GeneID: 8297347
NCBI-ProteinID: XP_002548327
UniProt: C5M8A2
Position
Unknown
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTEGGKKRTKARKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagcagaaaagaaaccagcttccaaagctccagctgaaaagaaaccagct
gccaaaaagaccgcttccactgaaggtggtaaaaaaagaaccaaggctagaaaagaaact
tactcctcatacatttacaaagttttgaaacaaacccacccagatactggtatttctcaa
aaagccatgtctattatgaactcctttgttaatgatatctttgaaagaattgcttctgaa
gcttctaaattagctgcttacaataagaaatctaccatttctgctagagaaatccaaacc
gctgttagattgatcttgccaggtgaattggctaaacatgctgtttccgaaggtaccaga
gctgtcaccaaatattcatctgcttctaattag

DBGET integrated database retrieval system