KEGG   Candida tropicalis: CTRG_02665Help
Entry
CTRG_02665        CDS       T01115                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ctp  Candida tropicalis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CTRG_02665
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CTRG_02665
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CTRG_02665
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CTRG_02665
Transcription machinery [BR:ctp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CTRG_02665
Spliceosome [BR:ctp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CTRG_02665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MSNIEDDSSISVDSIVDRLLEVRGSRPGKQVALSENEIRYLCTKAREIFIQQPILLELEA
PIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPEN
FFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLS
PDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQ
KHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILK
PADKKPRYAPANVANNRPGANQRKPKKTVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacatagaagacgattcctccatttctgtggactccattgtagaccgtttgctc
gaagttcgtggctcaaggccaggaaaacaagtggcattaagtgaaaacgaaatcagatat
ttatgtaccaaagcaagagaaatctttatccaacaacctatattgcttgagcttgaggct
cctataaagatttgtggggatatccacgggcaatattacgatcttcttcgtttgtttgaa
tacggtggcttcccaccagaggcaaattatcttttccttggtgactatgtcgatagaggt
aaacaatccttggaaacaatttgtttgttgttggcctataagatcaaatatccagaaaat
ttcttcattttaagaggtaatcacgaatgtgcatccattaatcgtatttacggtttctac
gacgaatgtaaaagaagatacaatattaaattgtggaaaacttttactgattgtttcaac
tgtttaccaattgcagctattatcgatgaaaaaatctttactatgcatggtggtttgtca
cctgacttgaactctatggaacaaatcagaagagttatgagaccaaccgatattccagat
gttggtttgttgtgtgatttattgtggtcagatccagataaggatatcactggatggtca
gaaaacgatagaggtgtgtcctttacttttggtccagatgttgtttctagatttttacaa
aaacacgatatggatttgatttgtcgtgcccatcaagttgttgaagatggttacgaattt
ttcagcaagcgtcaattggtgacattattctctgcaccaaactattgtggtgaatttgac
aatgctggtgccatgatgtctgttgatgaaagtttattgtgttccttccaaattttgaaa
cctgctgacaagaaaccaagatatgccccagcaaatgtggccaacaaccgtccaggtgcc
aaccaaagaaaaccaaagaagactgttaaataa

DBGET integrated database retrieval system