KEGG   Candida tropicalis: CTRG_02740Help
Entry
CTRG_02740        CDS       T01115                                 

Definition
nucleoporin GLE2
Orthology
K14298  
mRNA export factor
Organism
ctp  Candida tropicalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CTRG_02740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MSFLGSAATTSTTSASSAVTGQELLNDITINNPPEDSIEDLSFSPQQDLLAVASWDKKVR
IYEVDSNTGNNMGRAMYEHNAPVFSSRWSLDGTKIISGGADNQVKIFDLATQQAQQIGQH
DSAVKSVRYVECGPTNTQVVASGSWDKTLKYWDMRSPQPVSTINLPERVYSMDSSQKLLV
VGCADRHISIIDLNNPQQIFKSSQSPLKWQTRVVSCYPQANGFAIGSIEGRCAIQYITEN
EQKKFGFSFKCHRKQGGGSSTSTGGLRTTSSSSNESQAFSVNAISFHPIYGTFSTAGSDG
TFCFWDKDAKQRLKSFPELPGTVSATAFNKNGTIFAYAVSYDWSLGYMGNRPDYPNIIKL
HATKDVEIKQKNKR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcttaggaagtgcggcaactacttctactacttcagcatcaagtgcagttaca
ggtcaagaactattgaatgatataacgataaacaaccctcctgaagactcaattgaagat
ctttcattctcaccacaacaagatttattagccgtcgcaagttgggataaaaaagtcaga
atttatgaagtggattcaaatacaggtaacaacatgggtagagccatgtatgaacataat
gctccagttttctcatcacgttggtctttggatggtacaaaaatcatctctggtggggca
gacaaccaagtgaaaatattcgatttagcaacccaacaagcacaacaaattggtcaacat
gattctgctgtgaaatcagttagatatgttgaatgtggacctactaatacacaagttgtt
gcctccggatcctgggataaaacattaaaatattgggacatgagatcacctcagccagtt
tccacaatcaatttaccagaaagagtctactccatggatagttcacagaaactattagtt
gttggatgtgcagatcgtcatattagtataattgatttaaataacccccaacaaatcttc
aagagttcgcaatctcctttgaaatggcaaaccagagttgtttcatgttatccacaggca
aatggttttgctattggttcaattgaaggtagatgtgctatacaatacatcacagaaaat
gaacaaaagaaatttggtttctcattcaaatgtcatagaaaacaaggtggtggtagttcc
acttcaactggtggattaagaactaccagttcaagttctaatgaatcacaagctttctca
gtcaatgctatttcattccatccaatatatggtacattcagtacagctggatctgatggt
acattctgtttctgggataaagatgctaaacaaagattgaaaagtttcccagaattgccg
ggtactgtatctgcaactgcattcaacaagaatggtactatttttgcttatgcggtcagt
tatgattggtctttggggtacatgggcaacagaccagattatccaaatatcattaaatta
catgctactaaagatgttgaaatcaaacaaaagaacaagaggtaa

DBGET integrated database retrieval system