KEGG   Candida tropicalis: CTRG_02766Help
Entry
CTRG_02766        CDS       T01115                                 

Definition
transporter ATM1, mitochondrial precursor
Orthology
K05663  
mitochondrial ABC transporter ATM
Organism
ctp  Candida tropicalis
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ctp02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 702 aa AA seqDB search
MFRSIKLIQPFRTLRTSTTKFTTTSSSSWLIPNTIRRSILQQSQQRITFSRFFTQTKHVS
QQIVKPKVQQSIFGRKISTSESFMIKSLLKTIWPKDNFNFKIRVIIALSLLIASKLLNVQ
VPFYFKEIIDAMNINWSEDVGTVSAVIGSLILAYGGARFGAVLFGELRNAIFASVAQSAI
RRVAYNTFVKLLNMDLNFHLSRQTGGLTRAIDRGTKGISYVLSAMVFHIIPITFEITVVC
GILTYNYGATFAAMTFATMLAYSIFTIRTTAWRTKFRRQANSADNKAASVALDSLINYES
VKIFNNEAYQANKYDQSLTKYQQASVKVATSLAFLNSGQNFIFTSALTAMMYMGCQGVAN
GSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMENLFQLQSEPIRIKEIEGAPQ
LVLNETLPGEIKFENVTFGYHPDRPILKNATFTIPAGKKVAIVGPSGSGKSTILRLVFRF
YDIDSGRILIDGQDITKVSLESLRKKIGVVPQETPLFNDTILENIRYGRLDASDEEINKV
INSVQLDKLIKDLPDGVQTIVGERGMMISGGEKQRLAMARLLLKKAPITFFDEATSALDT
HTEQALLKTIRGIFRRDHSTNVSIAHRLRTIADADKIIVLNKGVVQEEGTHGELLSQSES
LYAQLWNIQENMDVEKELRLEEEQRVKAEQEKENQIFKQENK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaagtattaaactaatacaaccatttcgtacacttcgtacatccacaactaaa
tttactactacatcatcgtcatcatggcttatacctaatactatcagaagatcaatacta
caacaatcacaacaacggataacattttctagatttttcacacagacaaaacatgtttcc
caacaaattgtcaagccaaaagtacaacaatctatatttggtagaaaaattagtacttct
gaatcatttatgataaaatcattattaaaaacaatatggcctaaagataattttaatttt
aaaattcgtgttattatagcattatcattattaattgcatctaaattattaaatgttcaa
gttccattttattttaaagaaattattgatgccatgaatataaattggtctgaggatgta
ggtacagtaagtgcagttattggtagtttaatattagcttatggtggtgcaagatttgga
gcagtattatttggagaattaagaaatgccatatttgcaagtgttgcccaactggcaatt
agaagagtagcatataatacatttgttaaattattaaatatggatttaaatttccattta
tctagacaaactggtggattaactagagcaattgatagaggtactaaggggattagttat
gttttaagtgccatggtatttcatataattccaattacttttgaaattactgttgtttgt
ggtattttaacttataattatggtgctacttttgctgctatgacatttgcaaccatgttg
gcctattcgattttcactattagaacaactgcttggagaactaaatttagacgtcaagca
aatagtgctgataataaagcagcaagtgttgcattagattctttaattaattatgaaagt
gttaaaattttcaataatgaagcttatcaagctaataaatatgatcaatcattaactaaa
tatcaacaagctagtgttaaagttgcaacttcattggcatttttaaattctggacaaaat
ttcattttcacgtcagcattaacagcaatgatgtatatgggatgtcaaggtgttgccaat
ggtagtttaacagttggtgatttagttttaattaatcaattggtattccaattaagtgta
cctttgaatttcttgggttcagtttatcgtgaattaaaacaatctttaattgatatggag
aatttattccaactacaaagtgaacctataagaattaaagaaattgaaggtgctcctcaa
ttggttttaaatgaaacattaccaggggaaattaaatttgaaaatgttacatttggatat
catccagatcgtccaattttgaaaaatgctacatttactattccagcaggaaaaaaagtt
gccattgttggaccttcaggtagtggtaaatcaacaattttgagattagtgtttagattt
tatgatattgattctggtagaatattaattgatggacaagatataactaaagtttcattg
gaatcattaagaaagaaaatcggggttgttccacaagaaactccattatttaatgatact
atattggaaaatataagatatggtagattagatgccagtgatgaagaaattaataaagtt
ataaattcagttcaattagataaacttattaaagatttaccagatggtgtacaaaccatt
gttggagaaagaggtatgatgatttctggtggtgaaaaacaaagattagctatggcaaga
ttattattaaagaaagcaccaattacattttttgatgaagccacatctgcattagatact
catacagaacaagcattattgaaaacaattcgaggaatatttagacgtgatcatagtaca
aatgttagtattgctcatagattacgaaccattgctgatgccgataagattattgtcttg
aataaaggtgtagttcaagaagaagggacacatggtgaattattgagtcaatccgaaagt
ttgtatgctcaattatggaatattcaagagaatatggatgttgagaaagaattaagatta
gaagaagaacaaagagttaaagcagaacaggagaaggaaaaccaaatatttaaacaagaa
aacaaatag

DBGET integrated database retrieval system