KEGG   Candida tropicalis: CTRG_02870Help
Entry
CTRG_02870        CDS       T01115                                 

Definition
similar to arginase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ctp  Candida tropicalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ctp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MQLFLLLTLLPCILATDLAEKWGDLWPFQGVATFAHLEHFSCLIESDKQFDIGIIGVPFD
TAVSYRPGARFGPRAIRDASQRQTSLRGFNPRALFNPYKSWAKIVDCGDIPVTPMDNSLA
FKQMDEAFKDLLDKKSLNDTDVPPRFVALGGDHSVLLPHIRGLHKIYGPLNIIHFDAHLD
TWKPDKYPSFWESDQNEINHGSMLWKAHEEGLTTNTNIHAGLRTKLSGLEDLQDDDEQDF
IRIEADDIWLKGPEYVVNKILKTIPKDTPTYISVDVDVLDPGFTSGTGTQEPGGWLPREL
IHILRQIEGLTVVGADIVEVSPAYDIAEITATNGAQIAYEILTSMVKKGNLNKSLVKNVI
HTFDN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgttcttattactcacacttttaccttgtatattagccacagatttggctgag
aaatggggagacctttggccattccaaggagttgctacatttgctcacttagaacatttc
tcatgtttgatcgaatcagataaacaatttgatattggtatcattggtgttccttttgac
acagcagtctcatacagaccaggtgcacgttttggacctcgtgcaattagagatgcatct
caaagacaaaccagtttgcgtgggtttaatcctcgtgcattgttcaatccttataaatca
tgggcaaaaatagtggattgtggggatatccctgtgacaccaatggacaattctttggcc
tttaaacaaatggacgaagcatttaaggatttgttagataagaaatcattaaacgatact
gatgtacctccaagattcgttgccttgggaggagatcattctgtgttattgccacatatc
agaggtttacacaagatctatggaccacttaatataattcattttgatgctcacttggat
acttggaaaccagataagtatccttccttttgggaatccgaccagaatgaaatcaatcat
ggatctatgttgtggaaagcacacgaagaaggattgaccaccaacaccaatattcacgca
ggtttaagaacaaagctttctggactcgaagatttacaagatgatgacgaacaagacttt
atcagaattgaagctgatgacatatggttaaaaggacctgaatatgtggtgaacaaaatc
ttgaaaacaattccaaaagatactccaacttatatttcggttgatgtggacgttttagat
cctggtttcactagtggaacaggtactcaagaaccaggtggttggttaccaagagaattg
attcatattttaagacaaattgaaggtttgactgttgttggtgctgatatagttgaagtt
tctcctgcctatgatattgctgaaataaccgcaactaatggagcacaaattgcatatgag
atattgactagtatggtaaaaaaggggaatctcaataaatccttggttaagaatgtaatt
catacatttgataactag

DBGET integrated database retrieval system