KEGG   Candida tropicalis: CTRG_02879Help
Entry
CTRG_02879        CDS       T01115                                 

Definition
similar to potential formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ctp  Candida tropicalis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CTRG_02879
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CTRG_02879
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CTRG_02879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 286 aa AA seqDB search
MHFGMTGMVKLRNVKSHLIMMENGGDKKALKKIEDAVNEIKDEEDENENEEWPPRFSKFD
MELTKDDHKIEFAFTDARRLGRIRLLKGEEVKTNEDLLNTAPLNALGPDYSKPEVPPKQT
KPFVFGDPDPDHHGRPRLTIYEFNKLILSKKKPIKSLLLDQAFFAGVGNWVGDEIVFQAR
IHPNEVISNKIANDGSDDIHPVVQKLYDSLISVCEEAVLVEGDTSKFPKNWLMLYRWGKG
RKEKRKTPQGYSLDHVTVGGRTSCYCPDLQKMLKQESGRKRLKKEK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcattttggaatgacaggaatggttaaactacgaaatgtaaaatcacatttgataatg
atggaaaatggtggggataaaaaagcattgaaaaaaattgaagatgctgttaatgagatc
aaagacgaagaggatgagaatgaaaatgaggaatggccacctagattttcaaaatttgac
atggaattaaccaaagatgatcacaagatagaatttgcatttacagatgctagaagatta
ggaaggattaggttacttaaaggagaagaagtcaaaactaatgaagatttgctaaatact
gcaccattaaatgcattgggtccagattatagtaaaccggaagtaccaccaaaacaaacc
aagccatttgtttttggtgatcctgatccagaccaccatggacgaccacgattgacaata
tacgagtttaataaattgatcttatcaaaaaagaagccaataaaaagtttacttttagat
caagcattttttgcgggtgtgggcaattgggttggtgatgaaattgtatttcaagcaaga
atacatcctaatgaggtgatttccaataagatagcaaatgatggttccgatgatattcat
ccagtggtgcagaaattatacgattcattgatttctgtttgtgaagaagcagttttggta
gaaggtgatacatcaaagttccccaaaaattggttaatgttatatcgatgggggaaaggt
cgtaaagaaaagaggaaaacaccacagggttattccctagatcatgtcacagtaggtggt
agaacaagttgttattgtcctgatttgcaaaagatgcttaaacaagagtctggaagaaaa
cgtttaaaaaaagaaaaatag

DBGET integrated database retrieval system