KEGG   Candida tropicalis: CTRG_02894Help
Entry
CTRG_02894        CDS       T01115                                 

Definition
lysophospholipase 2 precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ctp  Candida tropicalis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ctp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 602 aa AA seqDB search
MISLLIFPLLFACLVICKSPTNSYAPGRVECPNFKLTRSAISGLNPDEKSYIDQRYKLAK
QSLSGFLHQAGMIDFDVDSFLATSNPTIGIAFSGGGYRAMLAGAGELSALDSRSKSPSIL
SGILQSANYIAGLSGGAWLTGTIASNDLITVDQILAQNSLWRLSNSLFAYHGFLFVLSNT
LMWTSIDLSVKLKMLSGSTVSITDVYSRALSYQFLSNYPSKGAAFCWSDITSLPSFQNSE
LPFPILSAVGREPGTSIINFNSTVFEFTPYEIGSWDPSLQNFMNIKYLGSKMNNGFANGK
CINGFDNAGFLMGTSSSLFNAVLLELNKLNFPSFTKSLINSIVINPFERLNVDVAHYNPN
PFYMSQNPNGKIANSRTLYLADGGEDGQNIPLLPLVHRNVSVIFAYDNSADENGWPDGTS
LVKTYERQFSHQGRDVAFPYVPDQYTFRNLNLTSKPTFFGCDAKNLTSLTDNIYDVPLVI
YNANRPFSYWSNTSTYKLKYSDQEKESMIANGYNVASRMNGQLDDEFAACIGCAIIRREQ
ERQGIEQSKQCQRCFEKYCWDGTVYKDAPLGDNFSNEGLTKSAQYYNANNVKGINNGGVD
IV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgatctctttgttgatttttccattgttatttgcttgtttggtaatttgtaaatcacct
accaatagttatgcacctggtagagttgaatgtccaaattttaaattaaccagatcagct
atatctgggttgaaccctgatgagaaatcatatattgatcaaagatataaacttgcaaag
caatcattgtctggatttcttcatcaagctggtatgattgattttgatgttgattcattc
ttagctacttcaaacccaactattggtattgctttcagtggtggtgggtaccgggcaatg
ctagctggtgctggagaattgagtgcattagattcaagatcgaaatcaccatctatactc
tctgggattcttcaaagtgcaaattacattgctgggttatctggtggagcatggttgact
ggtacaatagctagtaatgatctaattactgttgatcaaattttagcacaaaatagtctt
tggagattactgaattcattgtttgcataccatggattcttatttgtattaagtaataca
cttatgtggacaagtatagatctactggtgaagttgaaaatgctttctggatcaaccgtt
agtattactgatgtttattctcgtgctttgagttaccaatttttaagtaattaccctagt
aaaggtgctgcattttgttggtcagatatcacttcattgcctagttttcaaaattcagaa
ctaccattcccaatattatctgctgttggacgagaaccaggaacaagcattattaatttc
aattcaactgtatttgaatttacaccatatgaaattgggtcttgggacccaagtttacaa
aatttcatgaatatcaaatatcttggaagtaaaatgaacaatgggtttgccaacggtaaa
tgtatcaacggatttgataatgccggttttcttatgggtacttcatcttcattatttaat
gctgttttattagaattaaataaacttaacttccctagttttacaaagagtttgattaat
tcaattgtcattaatccatttgaacggttaaacgtcgatgttgctcattataatccaaac
ccattctatatgagtcaaaatccaaatgggaaaattgccaattcaagaacattatactta
gctgatggtggagaagatggtcagaatattcctttattaccattggttcatagaaatgtt
agtgtgatatttgcatatgataattccgcagatgaaaatggttggccagatggtacttca
ttggtgaaaacatatgaaagacaattttctcatcaagggcgagatgttgcattcccatat
gttcctgatcaatacactttcagaaacttgaatctaaccagtaaaccgacattttttgga
tgtgatgctaagaacttgacttcacttacagataatatctacgatgttcctttggttata
tacaatgctaaccgtccattcagttactggtcaaatacatctacatacaagttgaaatat
agtgatcaagaaaaagaaagcatgatagcaaatgggtataatgttgcttctcgtatgaat
ggacaacttgacgatgagtttgctgcatgcattggctgtgctattatcagaagagaacaa
gaacgccaaggtatagaacaatctaaacaatgccaacgctgctttgagaaatattgctgg
gatggtactgtgtataaagatgcaccattaggagataattttagtaacgaaggtttaaca
aaaagtgcacaatactataatgcaaacaacgtaaaaggtataaacaacggaggtgttgat
attgtataa

DBGET integrated database retrieval system