KEGG   Candida tropicalis: CTRG_02901Help
Entry
CTRG_02901        CDS       T01115                                 

Definition
NADH-cytochrome b5 reductase precursor
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ctp  Candida tropicalis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MIAQQFSKLANPRFLVPFAGATALSIALAAHYSSSANIISNESGKTFTDPNNWIDLKLAK
SVDLTHNTKHLYFKLANEDDVSGLVTASCLLTKFVTPKGSNVIRPYTPVSEVNQAGEIEF
VIKKYEGGKMSTHIFDLKEGDTLSFKGPIVKWKWEPNQFKSIALIGGGTGITPLYQLLHE
ITSNPADKTKVNLIYGNVSPSDILLKKEIDDIAEKHKDQVKVHYFVDKADNNDWKGEVGF
ITKEFLQGALDKPSSDFKVFVCGPPGLYKAISGAKVSPTDQGELTGHLKDLGFEKEHVFK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcaacaattttctaaacttgctaatcctagatttttggtcccatttgctggt
gccactgccttgtcaattgctttggctgctcactattcttcctccgcaaacattatttct
aatgaatccggaaaaactttcaccgacccaaacaactggattgacttgaaattggcaaaa
tctgttgatttgactcacaacaccaaacacttgtatttcaaattagccaatgaagatgat
gtttctggtttggttactgcttcttgtttgttgactaaatttgttactccaaaaggtagt
aatgtcattagaccatacactccagtctctgaagtcaaccaagctggtgaaattgaattt
gttatcaaaaaatacgaaggtggtaaaatgtctactcatatctttgacttgaaagaaggt
gacaccttatcattcaaaggtccaattgttaaatggaaatgggaaccaaaccaattcaaa
tcaattgctttgattggtggtggtactggtattactccattgtaccaattgttgcatgaa
attacttctaacccagctgacaagactaaagttaatttgatttacggtaacgtttcccca
agtgatattttattgaagaaagaaattgatgacattgctgaaaaacacaaggatcaagtt
aaagttcactactttgttgataaggccgataacaacgactggaaaggtgaagttggtttc
atcactaaagaattcttacaaggtgctttagataaaccaagtagtgactttaaagttttt
gtttgtggtccaccaggtttatacaaggctatttctggtgctaaagtttctccaactgat
caaggtgaattgactggtcacttgaaagatttgggtttcgaaaaagaacacgtctttaaa
ttctag

DBGET integrated database retrieval system