KEGG   Candida tropicalis: CTRG_02909Help
Entry
CTRG_02909        CDS       T01115                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ctp  Candida tropicalis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CTRG_02909
Exosome [BR:ctp04147]
 Exosomal proteins
  Proteins found in most exosomes
   CTRG_02909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1673 aa AA seqDB search
MSNDIPIDFTELTQLTQLGIPQTSLDFKSTTLESDSYICVRESGAQGNTVAIVNLKNNNE
VTRKNMTADNAIMHPKEFVISLRANGTTLQIFNLGSKQRLKAFTMDQPVIFWKWLNDQYL
GLVTQSSIYYWNVFDGTNDGPIKLSDRHHTLNNCQIINFVAEPALNWFAVTGIAQEDGRI
AGHIQLYSKSRNVSQAIEGHVCKFASLTLSGAVQPTKVFCVGNKNAQGQGNLHIIEIDHV
DGNPPFPKKAVDIFFPPDAANDFPISLQASDRYGIIYVLTKYGFIHLYDMETGGNLFVNR
ITADPVFTATSYNDGTGLLTINKAGQVLSVEVSRDKIVPYVLDKLSNVPLALALSSRGGF
PGAENLFQQQFQTYLNQGDYANAAKVAASSEQLRTQDTINKLKHITPQPGQISPILQYFS
TLLDRGTLNKFESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDTTLALAV
YIRANVNIKVVSCLAELGEFDKILPYCQKVGYNPDYTNLIQNLVRVNPDKASEFATSLLA
SPDANLNVEQIADLFFSQNYIQQGTAFLLDALKNDSPAEGHLQTKVLEINLLHAPQVADA
ILGNHMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLPSDWLVSYFGQL
NVEQSLACLKELLSQNVQQNLQVIIQVATKYSELIGPMKLIKLFEEYKCTEGLYYYLSSI
VNLTQDPDVVFKYIQAAAKMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLDDQLPLIIVC
DRFNFVHDLILYLYKNQYFKFIEVYVQSVNPTNTPQVVAGLLDVDCDEEIIKGLLMSVLG
RVPIKELVEEVEKRNRLKILLPFLEKTLEGGSNDQEVYNTLAKIYIDSNNSPEKFLQDNN
NYDTLVVGKYCEKRDPYLAYISYSKGGNDDQLIAITNENKMFKYQARYLLSKSDLTLWNK
VLTADNIHRRQLVDQVISTGIPELDDPEPISITVKAFMDNDLPEELMELLEKIILEPSPF
SENASLQGLMILTAIKADSSKVSSYIEKLDKFDPAEIAPLCIDNGLNEEAFEVYDKFEMR
TDAMKVLVEDIVSLDRAEQYAEKYDTPELYYQLGTAQLDGLRIPEAIDSYVKSKNPENFA
QVIEIAEHAGKEEELISFLDMARETLREPVIDGALINAYATLDRLSDMEKFVGGSNVADL
EAIGDKLFEAKNYKGAKILYSNVSKYSKLATTLVYLGDYQGAVDCARKASNTQVWKQVNN
ACIENKEFRLAQICGLNLIIDAEELPELVRTYEYNGYFNELISLFESGLGLERAHMGMFT
ELAILYAKYSPEKVMEHLKLFWSRINIPKVLTACEEAHLYPELIFLYCHYEEWDNAALTM
IERSEVAFDHSSFKEIIVKAPNLEIYYKAIQFYMNEQPSLLVDLLQVLTPKLDLPRVVRM
FVQSDNLPMIKPFLISVLEKNNSVVNSAYHDLLIEEEDYKSLRSSIENESNNRFNKLDLA
ERLEKHELIFFRQIAATLYTKEKKFNRAISILKTDKLWPDLLKTVAIAKSNKIAHEMLDY
FVETGNHECFVALLYTSYDYINYDYVVELSWLHNLSNFIKPYEISIVYENNKKLNEVYQD
LKKRQELEKKNEEEPSTAGAPLMLTNGPMSYQGTGVGSNLGYQPTGTGFGNAF
NT seq 5022 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgatattcctatcgatttcactgaattgactcagttgacacaattgggaatt
ccacaaacttcattagatttcaaatcaacaaccttagaatcagacagttacatatgtgta
cgtgagtcaggggcacaaggtaataccgttgccattgttaatttaaaaaacaataatgaa
gtcaccagaaagaatatgactgctgataatgcaatcatgcatccaaaggagtttgtaatt
tccttaagagccaacggaaccactttacaaatcttcaacttgggcagcaaacaaagatta
aaggcttttactatggatcaaccagtgatattctggaaatggctcaatgatcaatacttg
ggtttagtcactcaatcttctatttactactggaatgtatttgacggaaccaatgacggt
ccaattaagttaagcgatagacatcacactttaaacaattgtcaaatcatcaactttgtt
gccgaaccagctttaaactggtttgccgttactggtattgcccaagaagatggtcgtatt
gctggtcatattcaattatattccaaatcaagaaacgtttctcaagcaattgaaggtcac
gtttgtaaattcgcttcccttacattatctggtgccgttcaaccaactaaagttttttgt
gttggtaataagaatgcccaaggtcaaggtaatttgcacattattgaaatagaccatgtt
gacggaaacccaccattcccaaagaaagctgttgatatctttttcccacctgatgctgct
aatgatttcccaattagtttgcaagcttcagacagatatggtattatttatgttttgacc
aaatatggttttatacatttatacgatatggaaactggtggtaacttgtttgttaacaga
atcactgctgatcctgttttcactgccactagctacaacgacggtactggtttgttgacc
attaacaaagccggtcaagttttgagtgttgaagtttctcgtgacaagattgttccatat
gttttggacaaattatctaatgttccattagctttggctttatcttccaggggcggattc
ccaggtgccgaaaacttgttccaacaacaattccaaacttatttgaatcaaggtgattat
gccaatgctgctaaagttgctgcttcttcagaacaattacgtactcaagataccattaac
aaattgaaacacattactccacaaccaggtcaaatttctccaattttacaatatttctcc
actttattggacagaggaactttgaacaaatttgaatccattgaattggctaaaccagtt
ttgcaacaagatcgtaaaccattgtttgaaaaatggttgaaggaagataaattgacctca
tctgaagaattgggtgatattgtcaaatcatacaatgatactactttggctcttgccgtt
tatatcagagccaatgtcaacatcaaggttgtttcttgtttggctgaattgggtgaattt
gataaaattttgccatactgtcaaaaagttggctacaatccagattataccaacttgatc
caaaacttggtcagagtcaacccagataaagccagtgaatttgctacctcattgttagct
agtccagatgctaacttgaatgttgaacaaattgctgatttattcttctctcaaaactat
attcaacaaggtactgcattcttgttggatgctttgaagaatgattctccagctgaaggt
catttacaaaccaaagtcttggaaatcaatttattacatgctccacaagttgccgatgct
attttgggtaaccacatgtttagccattacgataaaccaaccattggtaaattgtgtgaa
aaatctggtttgttccaaagagctttagaacactacgatgatttgaaagatatcaagaga
gttattgtccacactaatgtcttaccaagtgattggttggtttcttactttggtcaattg
aatgttgaacaatcccttgcttgtcttaaggaattgttgagccaaaatgttcaacaaaac
ttgcaagttattatccaagttgctaccaaatactctgaattgattggtcctatgaagttg
attaagctttttgaagaatacaaatgtactgaaggcttatactactacttgagttctatt
gttaacttgacccaagatccagatgttgttttcaaatacatccaagctgccgccaagatg
aaccaaaccaaagaaattgaaagagttgttagagacaacaatgtttacaatggtgaaaag
gttaaaaactttttgaaagaattcaaattggatgatcaattaccattgatcattgtttgt
gacagattcaactttgttcacgatttgattttgtacttgtacaagaaccaatactttaaa
ttcattgaagtctatgttcaatcagtcaacccaacaaacaccccacaagttgttgccggt
ttattggatgttgattgtgatgaagaaatcattaaaggtttgttgatgtctgtcttgggt
agagttccaatcaaagaattagttgaagaagttgaaaagagaaacagattgaagattttg
ttgccattcttggaaaagactttggaaggtggctctaatgatcaagaagtttacaacact
ttggcaaagatttacattgattccaacaattctccagagaaattcttgcaagacaacaac
aactatgacactttagttgttggtaaatactgtgaaaagagagatccatacttggcttac
atctcttacagtaaaggtggtaacgatgaccaattgattgctattaccaatgaaaacaag
atgttcaaatatcaagctagatacttgttgtccaagtctgatctcactttgtggaacaaa
gttttaactgctgacaatatccacagaagacaattggttgaccaagttatctctactggt
attccagaattggatgacccagaaccaatttccatcactgtcaaggctttcatggataat
gatttaccagaagaattaatggaattattggaaaagatcatcttggaaccatctccattt
agtgaaaacgcttctttacaaggtttgatgattttgactgctatcaaagccgattcatct
aaagtttctagctacattgaaaaattggataaatttgatccagctgaaattgctccattg
tgtattgataatggtttgaacgaagaagcctttgaagtttatgacaaatttgaaatgaga
acagatgctatgaaagttttagttgaagatattgtttctttggacagagccgaacaatat
gctgaaaaatacgatactccagaattatattatcaattgggtactgctcaattagatggt
ttacgtattccagaagctattgattcttatgtcaaatccaagaacccagaaaactttgct
caagttattgaaattgctgaacatgctggtaaagaagaagaattgattagtttcttagat
atggctagagaaactttaagagaaccagttattgatggtgctttgatcaatgcttatgct
accttggatagattaagtgatatggaaaaatttgttggtggttccaatgttgctgatttg
gaagctattggtgacaaattgtttgaagccaagaactacaaaggtgccaagattttgtat
tccaatgtttctaaatactccaagttggctactacattggtttatttaggagattaccaa
ggtgctgttgattgtgctagaaaggcttctaacactcaagtctggaaacaagttaacaat
gcttgtattgaaaacaaagaattcagattggctcaaatttgtggtttgaacttgattatt
gatgcagaagaattaccagaattggttagaacctatgaatacaatggttactttaatgaa
ttgatttcccttttcgaaagtggtttaggtttggaacgagctcacatgggtatgtttact
gaattagccatcttgtatgctaaatactccccagaaaaggttatggaacatttgaaatta
ttctggtctagaatcaacattccaaaagttttaactgcttgtgaagaagctcatttgtac
ccagaattgattttcttgtactgccactatgaagaatgggataacgctgctttgactatg
attgaaagatccgaagttgcttttgaccattcatcattcaaggaaattattgttaaggca
ccaaacttggaaatctactacaaagctatccaattctacatgaatgaacaaccatcattg
ttggttgatttgttgcaagttttaacaccaaaattagatttgccaagagttgttagaatg
tttgttcaaagtgataacttgccaatgatcaaaccattcttgatttctgttttggaaaag
aacaattctgttgtcaactctgcttaccacgacttgttgattgaagaagaagactacaaa
tccttgagatcatctattgaaaacgaaagcaacaatagattcaataaattggatttggct
gaaagattagaaaaacatgaattgattttctttagacaaattgctgctactttgtacacc
aaagaaaagaaattcaacagagctatttctattttgaagactgataagttatggccagat
ttattaaagactgttgctattgccaaatccaacaagattgctcatgaaatgttggattat
tttgttgaaacaggtaaccatgaatgttttgttgctttgttgtacacttcatatgattac
attaactatgattacgtagttgaattatcttggttacacaacttgtccaactttattaaa
ccatatgaaatttctattgtttatgaaaacaacaagaaattgaatgaagtttatcaagat
ttgaaaaagagacaagaattggaaaagaagaatgaagaagaaccatcaactgccggtgca
ccattgatgcttactaatggaccaatgagttatcaaggtactggagttggtagcaacctt
ggataccaaccaactggtactggatttggtaatgctttttaa

DBGET integrated database retrieval system