KEGG   Candida tropicalis: CTRG_02947Help
Entry
CTRG_02947        CDS       T01115                                 

Definition
peroxiredoxin HYR1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ctp  Candida tropicalis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CTRG_02947
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CTRG_02947
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CTRG_02947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 160 aa AA seqDB search
MSEFYKLSPKDSKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNQKYKDQDVQIL
GFPCNQFKHQEPGTNDEIVSFCSLNYGVTFPVLDKINVNGDDADAVYKYLKSQKSGFLGM
KRIKWNFEKFLIDKDGKVVARFSSLTKPESITQKIDELLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattttataaattatcaccaaaagattccaaaggtgaaccatatccatttgaa
caattaaaaggtaaagttgttttaattgttaatgttgcaagtaaatgtggtttcactcca
caatataaaggtttagaagaattgaatcaaaaatataaagatcaagatgttcaaatttta
ggtttcccatgtaatcaattcaaacatcaagaaccaggtacaaatgatgaaattgtcagt
ttttgttcattaaattatggtgttactttccctgttttagataaaatcaatgttaatggt
gatgatgctgatgcagtttataaatacttgaaatctcaaaagagtgggttcttgggaatg
aaaagaattaaatggaattttgaaaaattcttaattgataaagatggtaaagttgttgca
agattcagttctttaactaaaccagaatctatcactcaaaaaattgacgaattattgaaa
taa

DBGET integrated database retrieval system