KEGG   Candida tropicalis: CTRG_02963Help
Entry
CTRG_02963        CDS       T01115                                 

Definition
halotolerance protein HAL2
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctp  Candida tropicalis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CTRG_02963
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CTRG_02963
Transfer RNA biogenesis [BR:ctp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CTRG_02963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MFSFALPRSIPKIFFIAFTPFIFHICFMRRIVITSLFILIVSLLLSVRTPARAFYTRYFT
MSSTTTTTHLYQKELEVATLAVKRASLLTKQLSDSIVQTANSGTLTKGDKSPVTVGDFAS
QAIINHAIKLNFPGDEIVGEEDSQELQENDSLASQVFDLINKIQSETSDSDDILGTLTTK
EEIYKSIDFGDSQGGTNGRFWALDPIDGTKGFLRGDQFAVCLALIENGKVVLGVIGCPNL
AEHIVSNEEHSGVVGGLYSAITGVGAYYAPLFNSGFTPLAEQKRINMKTHRDPKELKVVE
GVEKGHSSHSTQAQIKDKLGFDSETVARQTINLDSQVKYCVLASGQADIYLRLPISGTYR
EKIWDHAAGNVLIYESGGQVGDVTGKALDFGKGRTLDSQGVIAANKEIFSSVIEAVKAVI
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttttgctctccccagatcgatacctaaaatttttttcattgcttttactccg
ttcatttttcatatttgtttcatgagaagaatagttataacatcattattcatattgatt
gtgtctttgttactatctgttagaacccctgcaagagcattttacactcgttatttcaca
atgtcgtcaacaacaacaacaacccacttgtatcagaaggaactcgaagttgcaacattg
gctgtgaaacgtgcatccttgttaaccaaacaattgagtgactccattgtacaaacagcc
aattctggtacattaaccaaaggagataaatccccagtgactgttggggattttgcgctg
caagcaatcatcaaccatgcaatcaagttgaactttccaggtgatgaaattgtcggtgag
gaagattcacaagaattgcaagagaatgacagtttggctagtcaagtttttgatttgatc
aacaagattcaatctgaaaccagtgactctgatgatatattaggaaccttgaccaccaag
gaagagatttacaagagtattgattttggcgattcacaaggaggaaccaacggaagattc
tgggcattggatccaattgatggaactaaagggttccttagaggcgaccaatttgctgta
tgtcttgccttgattgaaaatggtaaagttgtcttgggagtcattggatgtccaaacttg
gctgaacacattgtttccaatgaagaacattctggtgtcgtcggtggtttgtattctgcc
attacaggtgttggtgcatactatgcgccattgttcaattctggattcaccccgcttgct
gagcaaaagagaatcaacatgaagacacacagagatccaaaggagttgaaagtagtcgaa
ggtgttgaaaaaggacattcttctcattccacacaagcccagatcaaggataagctagga
tttgatctggaaactgttgctcgtcaaacaatcaaccttgactcacaggtcaaatactgt
gtgttggctagtggacaagcagatatctacctcagattgccaatcagtggcacataccgt
gagaagatctgggatcacgctgctggtaacgttttgatctatgaaagtggcgggcaagtc
ggtgatgtcacaggtaaggcgttagattttggaaaaggtagaaccttggactcacaaggt
gtcattgctgccaacaaggaaatcttctccagcgtcatagaggcagtcaaggctgtaatt
aattag

DBGET integrated database retrieval system