KEGG   Candida tropicalis: CTRG_02963Help
Entry
CTRG_02963        CDS       T01115                                 

Definition
halotolerance protein HAL2
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctp  Candida tropicalis
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ctp00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MFSFALPRSIPKIFFIAFTPFIFHICFMRRIVITSLFILIVSLLLSVRTPARAFYTRYFT
MSSTTTTTHLYQKELEVATLAVKRASLLTKQLSDSIVQTANSGTLTKGDKSPVTVGDFAS
QAIINHAIKLNFPGDEIVGEEDSQELQENDSLASQVFDLINKIQSETSDSDDILGTLTTK
EEIYKSIDFGDSQGGTNGRFWALDPIDGTKGFLRGDQFAVCLALIENGKVVLGVIGCPNL
AEHIVSNEEHSGVVGGLYSAITGVGAYYAPLFNSGFTPLAEQKRINMKTHRDPKELKVVE
GVEKGHSSHSTQAQIKDKLGFDSETVARQTINLDSQVKYCVLASGQADIYLRLPISGTYR
EKIWDHAAGNVLIYESGGQVGDVTGKALDFGKGRTLDSQGVIAANKEIFSSVIEAVKAVI
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttttgctctccccagatcgatacctaaaatttttttcattgcttttactccg
ttcatttttcatatttgtttcatgagaagaatagttataacatcattattcatattgatt
gtgtctttgttactatctgttagaacccctgcaagagcattttacactcgttatttcaca
atgtcgtcaacaacaacaacaacccacttgtatcagaaggaactcgaagttgcaacattg
gctgtgaaacgtgcatccttgttaaccaaacaattgagtgactccattgtacaaacagcc
aattctggtacattaaccaaaggagataaatccccagtgactgttggggattttgcgctg
caagcaatcatcaaccatgcaatcaagttgaactttccaggtgatgaaattgtcggtgag
gaagattcacaagaattgcaagagaatgacagtttggctagtcaagtttttgatttgatc
aacaagattcaatctgaaaccagtgactctgatgatatattaggaaccttgaccaccaag
gaagagatttacaagagtattgattttggcgattcacaaggaggaaccaacggaagattc
tgggcattggatccaattgatggaactaaagggttccttagaggcgaccaatttgctgta
tgtcttgccttgattgaaaatggtaaagttgtcttgggagtcattggatgtccaaacttg
gctgaacacattgtttccaatgaagaacattctggtgtcgtcggtggtttgtattctgcc
attacaggtgttggtgcatactatgcgccattgttcaattctggattcaccccgcttgct
gagcaaaagagaatcaacatgaagacacacagagatccaaaggagttgaaagtagtcgaa
ggtgttgaaaaaggacattcttctcattccacacaagcccagatcaaggataagctagga
tttgatctggaaactgttgctcgtcaaacaatcaaccttgactcacaggtcaaatactgt
gtgttggctagtggacaagcagatatctacctcagattgccaatcagtggcacataccgt
gagaagatctgggatcacgctgctggtaacgttttgatctatgaaagtggcgggcaagtc
ggtgatgtcacaggtaaggcgttagattttggaaaaggtagaaccttggactcacaaggt
gtcattgctgccaacaaggaaatcttctccagcgtcatagaggcagtcaaggctgtaatt
aattag

DBGET integrated database retrieval system