KEGG   Candida tropicalis: CTRG_03025Help
Entry
CTRG_03025        CDS       T01115                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MLEECISSNDRVIINTNFMKIIDVNDNKTTITDGSPKLPAVPNKEAKPSSSSSSPSSPAP
QEPEPVTGESAVSSPAPPVRNWASFLQANAPPPQPTPKKTVKPKPASQTPIQPTPVSRSI
TPVAPFNINNESSQPLGILLLRIMFDSNYSVFNSLATFDVKPRGLTNSGNICYMNSILQI
LLYCEPFNRLLKLIETKSIGSLGVSPTPLLDATITFFNQFQEDSKAPVSPEDFYSSLTKQ
DKFSHLKWGQQEDAEEFLGYYIDGLNDEMLNEIKSVSTSQVDKLIQTYSQEHDSESSAKF
KYNIKSTIRRIKNEEEEEDGEWSQVNNKKNSTTTKIEVDPTPLNMIFGGQFKSVVTIPKQ
SSSFQRSITLDPFQHVQLDISAVDTIEDAFKHLNELENISYTNNNKEIQVKKQTFIEKLP
NVLIIHLKRFSYLKDQEIGVEKLRKKIDYSHDLIIPKEVLATEPSTPIKYQLSAVVYHHG
SSADAGHYTSDIHNAGVWWRIDDTFVKQIKNEEVLNAGTEENIKNAYILLYSRI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagaatgcatttcaagtaatgatagagtaattattaataccaattttatgaaa
attatagacgtaaacgacaacaaaacaaccatcactgatggcctgccaaaactaccagca
gtaccaaacaaagaagccaaaccatcatcatcatcatcatcaccatcatcaccagcaccc
caagaaccagaaccggtaacgggagagtcggcggtatcttcaccagcacctccagttcgt
aattgggcttcattcttacaagctaacgccccaccaccacaaccaactccaaagaaaaca
gttaagccaaaaccagcctcccagactcctatccaaccaacacctgtatcaagatcaata
acaccagtagcaccatttaatatcaataacgagtcttcacagccattaggaatattattg
cttaggattatgtttgacagtaactactctgtctttaattcattggcaacatttgatgtt
aaacctcgaggattgacaaattctgggaacatctgttacatgaattccatattacaaatt
ttgctttattgtgagccatttaatagattgttaaaacttatagagacgaagtcgattgga
agtttgggagtctctccaacaccattacttgatgccaccatcacttttttcaaccaattt
caagaagattccaaggcaccagtatcaccagaagatttttattcatccttgactaagcaa
gataaattttctcatttgaaatggggtcaacaggaagatgctgaagagtttttgggatac
tacattgatggtttgaatgatgagatgttgaacgaaatcaaactggtgagcacaagtcaa
gttgataaattaatacaaacatattctcaagaacatgacagtgagtcgtcagccaagttc
aagtacaatatcaaatccacaataagaagaatcaagaatgaagaagaagaagaagatggg
gagtggagtcaggtcaataacaagaaaaacagtactacaaccaaaatagaggttgatcca
acacctcttaatatgatttttggtggacaattcaaatcagtggtgacaatacccaagcaa
tcgtcatccttccaaagatccattaccttggaccccttccaacacgtacagttggatatt
tccgctgtcgatactattgaagatgcattcaaacacttgaatgagctcgagaatattagt
tacacaaataataacaaagagatacaggttaaaaaacaaacatttattgagaaattgcca
aatgttttgataatacacttgaagcgatttagctacctaaaagaccaagagattggtgtt
gaaaaattaagaaagaagatagactacagtcatgatttaataatacccaaagaagtattg
gccactgaaccaagcacgccgatcaaatatcagttactggctgttgtctaccatcatggt
agcagtgcggacgctggtcattacacaagtgatatacataatgcaggtgtatggtggaga
attgatgatacttttgtcaaacaaatcaagaacgaagaggtgttgaatgctggaacagaa
gagaatataaagaatgcatacattctattatattcaaggatttag

DBGET integrated database retrieval system