KEGG   Candida tropicalis: CTRG_03072Help
Entry
CTRG_03072        CDS       T01115                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp00310  Lysine degradation
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_03072
  Amino acid metabolism
   00310 Lysine degradation
    CTRG_03072
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTRG_03072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N Ribosomal_60s RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 8297687
NCBI-ProteinID: XP_002548775
UniProt: C5MAI0
Position
Unknown
AA seq 439 aa AA seqDB search
MLSRSIQSSLRRSTTVLKSTTVKSTLKAANVSAIRTLHRSSPSIASSYRPTPFLTFQRYA
SVSVKVPDMAESITEGTLAAFNKEVGDFVSQDETIATIETDKIDVEVNAPVSGTITEFLV
DVDATVEVGQEIIKIEEGEAPAGGAAAAPAKEEAKEEAPAKKEEKPAETAAAPKKEEPKK
ESKPSTPKKEEPKKTEESAPSFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTFNE
VDMTNLMDMRKQYKDEFLDKTGVKMGFMGAFSKAVCLALKEIPAVNAAIENNDTLVFRDY
ADISIAVATPKGLVTPVVRNAESLSILGIEKEISNLGKKARDGKLTLEDMTGGTFTISNG
GVFGSLYGTPIINMPQTAVLGLHGTKERPVTINGQIVSRPMMYLALTYDHRVVDGREAVT
FLKTVKELIEDPRKMLLLE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttatctagatcaattcaatcctcattgagacgtagtactaccgttctcaaatctaca
actgttaaatccactttaaaagctgctaatgtttctgccattagaaccctccatagatca
tccccatcaattgcctcaagttatagaccaaccccatttttaactttccaaagatatgca
agtgtttctgtaaaagtcccagatatggctgaatctattactgaaggtacattggctgct
tttaacaaagaagtaggtgattttgtcagtcaagatgaaaccattgccactattgaaacc
gataaaattgatgttgaagtcaatgctccagtttctggtaccattactgagtttttagtt
gatgttgatgccactgttgaagttggacaagaaatcatcaagatcgaagaaggtgaagct
ccggccggcggtgctgctgctgccccagccaaagaagaagctaaagaagaagccccagcc
aagaaagaagaaaaaccagctgaaaccgctgctgctccaaagaaagaagaaccaaagaaa
gaaagcaaaccttctacccctaagaaagaagaaccaaaaaagacagaagaatccgctcca
tcattcaccaacttctctagaaacgaagaaagagttaaaatgaacagaatgagattgaga
attgccgaacgtcttaaggaatcacaaaacaccgctgcttcattgaccactttcaatgaa
gttgatatgactaacttgatggatatgagaaaacaatacaaggacgaattccttgataaa
accggtgtcaagatgggtttcatgggtgcattctccaaggctgtttgtttagctcttaaa
gaaatcccagctgtcaatgctgccattgaaaacaacgacactttggttttcagagattac
gctgatatttctattgctgttgccacaccaaagggtttggtcactccagttgttagaaat
gctgaatcattatctattttgggaattgaaaaagaaatctccaacttgggtaagaaagcc
agagatggtaaattgactttggaagatatgactggtggtactttcaccatttctaacggt
ggtgttttcggttccttatacggtactccaatcatcaacatgccacaaactgctgtttta
ggtttacatggtactaaagaaagaccagttaccatcaatggtcaaattgtttcaagacca
atgatgtacttggctttgacctatgatcacagagttgttgatggtcgtgaagctgtcact
ttcttaaagactgttaaagaattaattgaagatccaagaaagatgttgttgttagaataa

DBGET integrated database retrieval system