KEGG   Candida tropicalis: CTRG_03072Help
Entry
CTRG_03072        CDS       T01115                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctp  Candida tropicalis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRG_03072
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_03072
  Amino acid metabolism
   00310 Lysine degradation
    CTRG_03072
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTRG_03072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MLSRSIQSSLRRSTTVLKSTTVKSTLKAANVSAIRTLHRSSPSIASSYRPTPFLTFQRYA
SVSVKVPDMAESITEGTLAAFNKEVGDFVSQDETIATIETDKIDVEVNAPVSGTITEFLV
DVDATVEVGQEIIKIEEGEAPAGGAAAAPAKEEAKEEAPAKKEEKPAETAAAPKKEEPKK
ESKPSTPKKEEPKKTEESAPSFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTFNE
VDMTNLMDMRKQYKDEFLDKTGVKMGFMGAFSKAVCLALKEIPAVNAAIENNDTLVFRDY
ADISIAVATPKGLVTPVVRNAESLSILGIEKEISNLGKKARDGKLTLEDMTGGTFTISNG
GVFGSLYGTPIINMPQTAVLGLHGTKERPVTINGQIVSRPMMYLALTYDHRVVDGREAVT
FLKTVKELIEDPRKMLLLE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttatctagatcaattcaatcctcattgagacgtagtactaccgttctcaaatctaca
actgttaaatccactttaaaagctgctaatgtttctgccattagaaccctccatagatca
tccccatcaattgcctcaagttatagaccaaccccatttttaactttccaaagatatgca
agtgtttctgtaaaagtcccagatatggctgaatctattactgaaggtacattggctgct
tttaacaaagaagtaggtgattttgtcagtcaagatgaaaccattgccactattgaaacc
gataaaattgatgttgaagtcaatgctccagtttctggtaccattactgagtttttagtt
gatgttgatgccactgttgaagttggacaagaaatcatcaagatcgaagaaggtgaagct
ccggccggcggtgctgctgctgccccagccaaagaagaagctaaagaagaagccccagcc
aagaaagaagaaaaaccagctgaaaccgctgctgctccaaagaaagaagaaccaaagaaa
gaaagcaaaccttctacccctaagaaagaagaaccaaaaaagacagaagaatccgctcca
tcattcaccaacttctctagaaacgaagaaagagttaaaatgaacagaatgagattgaga
attgccgaacgtcttaaggaatcacaaaacaccgctgcttcattgaccactttcaatgaa
gttgatatgactaacttgatggatatgagaaaacaatacaaggacgaattccttgataaa
accggtgtcaagatgggtttcatgggtgcattctccaaggctgtttgtttagctcttaaa
gaaatcccagctgtcaatgctgccattgaaaacaacgacactttggttttcagagattac
gctgatatttctattgctgttgccacaccaaagggtttggtcactccagttgttagaaat
gctgaatcattatctattttgggaattgaaaaagaaatctccaacttgggtaagaaagcc
agagatggtaaattgactttggaagatatgactggtggtactttcaccatttctaacggt
ggtgttttcggttccttatacggtactccaatcatcaacatgccacaaactgctgtttta
ggtttacatggtactaaagaaagaccagttaccatcaatggtcaaattgtttcaagacca
atgatgtacttggctttgacctatgatcacagagttgttgatggtcgtgaagctgtcact
ttcttaaagactgttaaagaattaattgaagatccaagaaagatgttgttgttagaataa

DBGET integrated database retrieval system