KEGG   Candida tropicalis: CTRG_03135Help
Entry
CTRG_03135        CDS       T01115                                 

Definition
aspartate transcarbamylase
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
ctp  Candida tropicalis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ctp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ctp00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2041 aa AA seqDB search
MISLSINPATGNNSLMFSNLMIQTSRIWVAKVSTKKPVLYTPKEGVKLGKNGKPIRILAV
DVGMKYNQIRCFVRRGVELLVVPWDYDFTKEEYDGLFISNGPGDPAVMNETVQRLKNVIK
EGKTPIFGICLGHQLLARATGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGYAVDTE
TLTDGWKELFVNANDGSNEGIYHESKPFFSVQFHPESTPGPRDTEFLFDVFIQSVVEFNK
SGVYKQVEFPGGKIAENRAAHPRVDAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEG
IYTILINPNIATIQTSKGLADKVYFLPVTPEFVRKVIEHERPDGIYCTFGGQTALSVGIA
LKDEFEGLGVKVLGTQIDTVITTEDRELFAAAMLEINEKCARSEAVNNVQEAIEAANAIG
YPLIVRAAYALGGLGSGFADNEEELVDLCNKAFATSPQVLVERSMKGWKEVEYEVVRDAF
DNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQY
ALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEIKNSVTKSTSAC
FEPSLDYCVVKIPRWDLKKFTRVSALLSSSMKSVGEVMSIGRTFEEAIQKAIRSTDYHNL
GFNKTAALMSIDIDQELQTPSDQRLFAIANALSDGYSVEKVWKLTNIDKWFLNKLDGLIK
FGNKIASYGTKEDVPVSILRQAKQLGFEDRQIAKFLGSNEVAIRRLRKDAGIIPFVKQID
TVAAEFPAFTNYLYITYNADSSDVKFDDNGVIVLGSGVYRIGSSVEFDWCAVRAIRTLRE
NNIKTVMINYNPETVSTDYDEADRLYFETINLERVLDIYELEQSSGVVISMGGQTSNNIA
LPLYRQNVKILGTSPEMIDSAENRYKFSRMLDKIGVDQPAWKELTSIDDAESFAEKVGYP
VLVRPSYVLSGAAMNTVYSKDDLASYLTQAVDVSPDYPVVITKYIENAKEIEMDAVAKDG
KMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIVEATAKIGKALDITGPYNIQFI
AKDNDIKVIECNVRASRSFPFVSKVVGVDLIEMATKAMMDLPLVPYPGERLPEDYCAVKV
PQFSFSRLAGADPVLGVEMASTGEVATFGRNKYEAYLKSLISTGFKLPKKNILFSIGSFK
EKQELLPSIAKLHELGYKIFATAGTADFIKEHGIPVHYLEVLSKDEDQKSEYNLSQHLAN
NLIDLYVNLPSANRFRRPASYMSKGYESRRMAVDYAVPLVTNVKNAKLLVEAIARNISLD
VSNRDAQTSHGTAVIPGLINITAFATSFDDFEETTKESLAAGFTFNAFLPHTQAGASVTD
YRSLVDAIDAVGAAAYTDYSVAVAATETNSQSASDAADNAGSLFVPFNDFANSKVSALTA
QFTSWPTSKPIVTDAKTTDLASVLLLASLYNRSIHITNVSSKEDLDLIKMAKDKGLQVSC
DVAVHALFVSKNELNFPFLPAKEDQEYLWANLDQVDCFSIGVLPYLIAKACNVKIVPGLG
IKEVIPLLLTAVRDGKLTIDDITAKFHDNPARIFNLPKQDAQVVVDLDRFAEVEPVYPEF
AKLRLRGAIERVSFHNETVVLDGAVLATGILGKNEVAPRSIFGSTAGVAESPRLGNKRVS
FGGADIRRPSFTPETPQPQPAVFEKLGSELVSQPIAGSLGEIAALSDYIRNNNAFLRNNF
ISVKDITRSDLHSLFAVAQEMRAQVERQGVLDILKGRVLATMFYEPSTRTSTSFDAAMQR
LGGRVVAVDSASSSVKKGETLQDTIRTLSCYADAIVLRHPSESSADVAAKYSPVPIINAG
NGTKEHPTQALLDLFTIREELGTVNGITVTFMGDLKYGRPVHSLCQLLKHYNVRVQLVAP
KELAIPEEIRQLLIENNMLKIESEELTKDILAKSDVLYCTRVQEERFSDKEQYQRLKDTY
IVDNKILSNAKQHMCVMHPLPRTNEIREEVDFDQRAAYFRQMRHGLFIRMALLAMVIGVD
F
NT seq 6126 nt NT seq  +upstreamnt  +downstreamnt
atgatatcattgctgataaatccggcaactggaaacaattctttgatgttcctgaatttg
atgatccaaacgtcaagaatttgggttgccaaagtttccactaaaaaaccagtcttgtac
actccaaaggaaggtgtcaaattgggtaagaacggtaagccaatcagaattcttgctgtt
gatgttggtatgaaatacaaccaaattagatgttttgttagaagaggtgttgaattgtta
gttgttccatgggactatgatttcaccaaagaagaatacgatggtttgtttatctccaac
ggtccaggtgatccagcagtcatgaatgaaaccgttcaaagattaaagaacgtcattaaa
gaaggcaaaactccaatttttggtatttgtttgggtcatcaattattggccagagctact
ggtgcttctactttgaaattgaagtttggtaatagaggtcacaatatcccatgtacttct
actatttctggtagatgttacatcacttctcaaaaccatggttatgctgttgataccgaa
accttaactgatggttggaaggaattgtttgtcaatgccaacgatggttccaatgaaggt
atttaccacgaatctaaaccatttttctctgttcaattccatccagaatccactccaggt
ccaagagataccgaattcttgtttgatgttttcattcaatccgttgttgaattcaacaaa
tctggtgtttacaaacaagttgaattcccaggtggtaagattgctgaaaacagagctgcc
cacccaagagttgatgccaaaaaagttttggttttgggttctggtggtttatccattggt
caagctggtgagtttgattactctggttctcaagccattaaagctttgaaagaagaaggt
atttacaccattttgatcaatccaaacattgccactattcaaacttctaaaggtttggct
gataaagtttactttttgccagttactccagaatttgttagaaaagttatcgaacatgaa
agaccagatggtatttactgtacttttggtggtcaaactgctttgagtgttggtattgcc
ttgaaggacgaatttgaaggtttgggtgttaaagtcttgggtacccaaattgatactgtt
atcactactgaagatagagaattgtttgctgctgccatgttggaaatcaacgaaaaatgt
gccagatctgaagctgttaacaatgtccaagaagccattgaagccgctaatgctattggt
tatccattgattgtcagagccgcttatgccttgggtggtttaggttctggtttcgctgac
aatgaagaagaattggttgatttgtgtaacaaagcttttgccacttctccacaagttctt
gttgaaagatccatgaagggttggaaagaagttgaatatgaagttgttcgtgatgctttt
gacaactgtattaccgtttgtaacatggaaaactttgatcctttgggtatccatactggt
gattccattgttgttgctccatcccaaactttatccgatgaagattacaacatgttgaga
actactgctgttaacgtcatcagacatttgggagttgttggtgaatgtaacattcaatat
gccttgaacccattctccaaggagtactgtattattgaagtcaatgctagattgtctcgt
tcttctgctttggcctctaaagccactggttatcctttagcttatactgctgctaaattg
ggtttgaacattccattgaatgaaattaaaaactctgttaccaaatctaccagtgcttgt
tttgaaccttctttggattactgtgttgtcaagattccaagatgggatttgaagaaattc
accagagtttctgctttgttgtcttcttccatgaaatctgttggtgaagttatgtccatt
ggtagaactttcgaagaagccattcaaaaggctattagatcaaccgattaccacaacttg
ggtttcaacaagactgctgctttgatgtctattgacattgaccaagaattgcaaactcct
tctgatcaacgtttgtttgctattgccaacgctttatccgatggctactctgttgaaaaa
gtttggaaattaaccaacattgacaaatggttcttgaacaaattagatggtttgatcaaa
tttggtaacaagattgcttcttatggtactaaagaagatgttccagtttctatcttgaga
caagccaaacaattgggtttcgaagatagacaaattgccaaattcttgggatctaatgaa
gttgccattagaagattgagaaaagatgctggtatcattccatttgttaaacaaatcgat
accgttgctgctgaattcccagctttcaccaactatttgtacatcacctataatgctgat
tcctcagatgttaaattcgatgacaatggtgttatcgtcttgggttcaggtgtttacaga
attggttcctctgttgaattcgattggtgtgctgtcagagctattagaactttgcgtgaa
aacaacatcaagactgttatgatcaattataacccagaaaccgtttccactgattatgat
gaagctgatagattgtatttcgaaaccatcaacttggaaagagtcttggatatttatgaa
ttggaacaatcctctggtgttgtcatctctatgggtggtcaaacctcaaacaacattgcc
ttgccattgtacagacaaaatgtcaagatcttgggtacttctccagaaatgattgattcc
gctgaaaacagatacaagttctccagaatgttggataaaatcggtgtcgatcaaccagct
tggaaagaattgacttctattgacgatgctgagtcatttgctgaaaaagttggttatcca
gttttggttcgtccatcttatgtcttgtctggtgctgctatgaacactgtctattctaaa
gatgatttggcttcatacttgacccaagccgttgatgtttctccagattatccggttgtc
attaccaaatatattgaaaatgccaaagaaattgaaatggatgccgttgctaaagacggt
aaaatgatcatgcacgttgtttctgaacacgttgaaaatgctggtgtccattctggtgat
gccactttgattgttccaccacaagatttggatccagaaaccgtcagaagaattgttgaa
gccactgccaagattggtaaggctttggatatcactggtccatacaacattcaatttatt
gccaaagataacgatatcaaggttattgaatgtaacgttagagcttcaagatctttccca
tttgtttctaaggttgtcggtgttgatttgattgagatggccaccaaggctatgatggac
ttgccacttgttccatacccaggtgaaagattaccagaagattattgtgctgttaaagtt
ccacaattctccttctctagattggctggtgctgatcctgttttgggtgttgaaatggct
tctactggtgaagttgccacttttggtagaaacaaatacgaagcctacttgaaatctttg
atttcaactggtttcaaattgccaaagaagaatatcttgttctctattggttcattcaag
gaaaaacaagaattgttaccaagtattgccaaattgcacgaattgggttacaagattttt
gccactgctggtactgctgatttcattaaagaacatggtatcccagttcattatttggaa
gttttgagcaaagatgaagatcaaaagtccgaatataacttgagtcaacatttggctaac
aacttgattgacttgtatgtcaatttaccatctgccaacagattccgtcgtccagcttct
tacatgtccaagggttacgaatctcgtcgtatggctgttgattatgctgtcccattggtt
accaatgttaagaacgctaaattgttggttgaagccatcgcaagaaacatttcattggat
gtttccaacagagacgctcaaacttctcacggtactgccgttatcccaggtttgatcaac
atcactgcttttgctacttcatttgatgatttcgaagaaaccaccaaagaatcattagct
gctggtttcaccttcaatgctttcttgccacacacccaagccggtgcttcagtcactgat
tacagatctcttgttgatgccattgatgctgttggtgctgctgcttacactgattattca
gttgccgttgctgctaccgaaaccaactctcaaagtgccagtgatgctgccgacaatgct
ggttctttgtttgttccattcaatgattttgccaactctaaggtttctgcccttacagct
caattcacctcatggccaaccagtaaaccaattgttactgatgctaaaaccactgatttg
gcttctgttttgttgttggcttccttatacaacagatccatccatatcactaacgtttct
tctaaagaagatttggatttgattaagatggctaaagacaagggattacaagttagttgt
gatgttgctgttcatgctttgtttgtgtctaagaatgaattaaacttcccattcttgcca
gctaaggaagatcaagaatacttgtgggctaacttggatcaagttgattgtttctccatt
ggtgtcttgccatacttgattgctaaagcttgtaatgttaagattgttccaggtttgggt
atcaaagaagttatcccattgttgttgactgctgttagagatggtaaacttaccattgat
gacatcacagctaaattccacgacaatccagctagaatcttcaacttgccaaaacaagat
gctcaagttgttgttgatttggacagatttgctgaagttgaaccagtttacccagaattt
gctaaattgagattgagaggtgccattgaaagagtttctttccataatgaaactgttgtt
ttggatggtgctgttttggctactggtatcttgggtaagaatgaagttgctccaagaagt
atatttggttctaccgccggtgttgctgaatcaccaagacttggtaacaagagagtttca
tttggtggtgctgatatccgtcgtccatcattcactccagaaactccacaaccacaacca
gctgtttttgaaaaattgggttctgaattggtttctcaaccaattgctggatctttgggt
gaaattgctgcattgagtgattacattagaaacaacaatgctttcttgagaaacaacttt
atctcagttaaggatatcaccagatctgacttgcattctttgtttgctgttgcccaagaa
atgagagctcaagttgaaagacaaggtgttttggatatcttgaaaggaagagttttggct
accatgttctatgaaccatctactagaacttctacttcatttgatgctgctatgcaaaga
ttaggtggtagagttgttgctgttgatagtgcttcctcatcagttaaaaagggtgaaact
ttacaagataccatcagaactttatcatgttatgctgatgctattgttttgagacatcca
tctgaatcctcagctgatgttgctgccaaatactctccagttccaattatcaatgctggt
aatggtactaaagaacacccaactcaagctttgttagatttgttcaccatcagagaagaa
ttaggtactgtcaatggtatcactgttaccttcatgggtgatttgaaatacggtagacca
gttcattccttgtgtcaattattgaaacattacaatgttagagttcaattggttgcacca
aaagaattggctattccagaagaaatcagacaacttttgattgaaaacaatatgttgaag
attgaaagtgaagaattaactaaagatattcttgccaaatctgatgttttgtactgtact
agagttcaagaagaaagattttctgataaagaacaatatcaaagattgaaagatacttat
attgttgataacaagatcttgagtaatgctaaacaacacatgtgtgttatgcatccatta
ccaagaactaatgaaatcagagaagaagttgatttcgatcaaagagctgcttatttcaga
caaatgagacatggattatttattagaatggctttattagctatggttattggcgttgat
ttttaa

DBGET integrated database retrieval system